Recombinant Mouse ATP-binding cassette sub-family G member 2 (Abcg2)

Code CSB-CF745859MO
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Abcg2
Uniprot No.
Alternative Names
Abcg2; Abcp; Bcrp1; Broad substrate specificity ATP-binding cassette transporter ABCG2; ATP-binding cassette sub-family G member 2; Breast cancer resistance protein 1 homolog; Urate exporter; CD antigen CD338
Species
Mus musculus (Mouse)
Expression Region
1-657
Target Protein Sequence
MSSSNDHVLVPMSQRNNNGLPRTNSRAVRTLAEGDVLSFHHITYRVKVKSGFLVRKTVEK EILSDINGIMKPGLNAILGPTGGGKSSLLDVLAARKDPKGLSGDVLINGAPQPAHFKCCS GYVVQDDVVMGTLTVRENLQFSAALRLPTTMKNHEKNERINTIIKELGLEKVADSKVGTQ FIRGISGGERKRTSIGMELITDPSILFLDEPTTGLDSSTANAVLLLLKRMSKQGRTIIFS IHQPRYSIFKLFDSLTLLASGKLVFHGPAQKALEYFASAGYHCEPYNNPADFFLDVINGD SSAVMLNREEQDNEANKTEEPSKGEKPVIENLSEFYINSAIYGETKAELDQLPGAQEKKG TSAFKEPVYVTSFCHQLRWIARRSFKNLLGNPQASVAQLIVTVILGLIIGAIYFDLKYDA AGMQNRAGVLFFLTTNQCFSSVSAVELFVVEKKLFIHEYISGYYRVSSYFFGKVMSDLLP MRFLPSVIFTCVLYFMLGLKKTVDAFFIMMFTLIMVAYTASSMALAIATGQSVVSVATLL MTIAFVFMMLFSGLLVNLRTIGPWLSWLQYFSIPRYGFTALQYNEFLGQEFCPGFNVTDN STCVNSYAICTGNEYLINQGIELSPWGLWKNHVALACMIIIFLTIAYLKLLFLKKYS
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Broad substrate specificity ATP-dependent transporter of the ATP-binding cassette (ABC) family that actively extrudes a wide variety of physiological compounds, dietary toxins and xenobiotics from cells. Involved in porphyrin homeostasis, mediating the export of protoporphyrin IX (PPIX) from both mitochondria to cytosol and cytosol to extracellular space, it also functions in the cellular export of heme. Also mediates the efflux of sphingosine-1-P from cells. Acts as a urate exporter functioning in both renal and extrarenal urate excretion. In kidney, it also functions as a physiological exporter of the uremic toxin indoxyl sulfate. Also involved in the excretion of steroids like estrone 3-sulfate/E1S, 3beta-sulfooxy-androst-5-en-17-one/DHEAS, and other sulfate conjugates. Mediates the secretion of the riboflavin and biotin vitamins into milk. Extrudes pheophorbide a, a phototoxic porphyrin catabolite of chlorophyll, reducing its bioavailability. Plays an important role in the exclusion of xenobiotics from the brain. It confers to cells a resistance to multiple drugs and other xenobiotics including mitoxantrone, pheophorbide, camptothecin, methotrexate, azidothymidine, and the anthracyclines daunorubicin and doxorubicin, through the control of their efflux. In placenta, it limits the penetration of drugs from the maternal plasma into the fetus. May play a role in early stem cell self-renewal by blocking differentiation (Probable).
Gene References into Functions
  1. It is located in the blood-brain barrier limits the entry of endogenous compounds and xenobiotics into the brain, and its expression and activity are regulated by estrogen. PMID: 29574357
  2. The hypothesis that ABCG2 plays a fundamental role during mESC differentiation or that regulation of the receptor by xenobiotics may be associated with altered mESC differentiation could not be supported. PMID: 28990372
  3. Ultrasound reverses chemoresistance in breast cancer stem cell like cells by reducing ABCG2 expression. PMID: 28935760
  4. Which raises the possibility that EGFR-inhibiting drugs may cause ABCG2-mediated DDIs. PMID: 28790147
  5. We conclude that mdr1b and bcrp are essential to ovarian protection from chemotoxicity and may have an important physiological role in the ovary. PMID: 28216407
  6. deficiency in skin impairs re-epithelialization in cutaneous wound healing PMID: 26739701
  7. conclusion, MDR1 and BCRP are expressed on apical membranes of the rodent placental SynT-II layer. PMID: 27616577
  8. Bcrp1 (Abcg2), the murine orthologue of the ABC transporter Breast Cancer Resistance Protein (BCRP, ABCG2), has at least four alternative promoters that are designated by the corresponding four alternative first exons produced: E1U, E1A, E1B, and E1C. In-silico protocols are presented to predict alternative promoter usage for Bcrp1. PMID: 27286290
  9. Report novel pyrimido[1'',2'':1,5]pyrazolo[3,4-b]quinolones that reverse ABCG2-mediated resistance in cancer cells. PMID: 27012188
  10. [(18)F]Mefway is modulated by P-gp, and not by Bcrp in rodents. PMID: 26250653
  11. P-gp, Bcrp, Mrp1 and Mrp4 are differentially expressed at the outer and inner blood retinal barrier, resulting in an altered ability to limit substrate distribution at the retina as compared with the blood brain barrier PMID: 26507673
  12. Coadministration of ceritinib with a dual ABCB1 and ABCG2 inhibitor may improve treatment of brain (micro) metastases. PMID: 26361725
  13. Pparalpha complex translocates from the cytoplasm into the nucleus and further recruits coactivators and transcription machinery which induce the transcription of Abcg2 gene and ultimately results in upregulation of Bcrp protein expression and function PMID: 26465636
  14. Among the ABC drug transporters, only ABCG2 was expressed at highly increased levels in a mouse G3 medulloblastoma model. PMID: 26199091
  15. The studies using Bcrp KO mice serve as an estimation of the clinical plasma concentration-time curve changes in ABCG2 421C>A variants for BCRP substrate drugs with the F ratio correcting the systemic clearance change by Bcrp knockout in Bcrp KO mice. PMID: 25380981
  16. the renal urate excretion was increased in Abcg2-knockout mice PMID: 24940679
  17. Data indicate that the brain penetration of ABT-888 in both Abcb1a/1b-/- and Abcb1a/1b-/-;Abcg2-/- mice was significantly higher than in wild-type mice. PMID: 24647572
  18. Expression profiling of mRNA isoforms revealed that E1b is predominantly expressed and induced in the lactating mammary gland. E1b promoter sequences in the virgin gland are already hypomethylated and marked with the open chromatin histone mark H3K4me2. PMID: 25117410
  19. Abcg2 plays a cytoprotective role in response to in vivo oxidative stress. PMID: 24727496
  20. CYT387 was efficiently transported by both human MDR1 and BCRP, and very efficiently by mouse Bcrp1 and its transport could be inhibited by specific MDR1 inhibitor, zosuquidar and/or specific BCRP inhibitor, Ko143. PMID: 23827160
  21. Inhibitors also demonstrated similar effects on human and mouse ABCG2. PMID: 23868912
  22. This hypoxia-induced ERK 1/2-dependent ABCG2 expression results in resistance to H/R injury, which partially explains the mechanism by which ABCG2 contributes to cellular protection in kidney SP cells. PMID: 23032069
  23. In Bcrp1;Mrp2;Mrp3(-/-), but not Bcrp1;Mdr1a/b;Mrp(-/-) mice. PMID: 24334255
  24. Bioluminescent imaging of drug efflux at the blood-brain barrier mediated by the transporter ABCG2. PMID: 24297888
  25. In conclusion, nuclear transcription factor SF-1 is involved with the regulation of a novel promoter of Bcrp1 that governs transcription of the E1U mRNA isoform in mice. PMID: 24189494
  26. Both p-glycoprotein and breast cancer resistance protein restrict brain access for several atiepileptic drugs, information which may be useful in development of treatments for refractory epilepsy. PMID: 23588114
  27. Data indicate that Abcc4 limits the brain penetration of camptothecin analogues and teams up with Abcb1a/b and Abcg2 to form a robust cooperative drug efflux system. PMID: 23461902
  28. finding that ABCG2 deficiency can generate dysfunctional mitochondria in hepatocytes raises concerns regarding the systematic use of ABCG2 inhibitor in cancer patients PMID: 23954234
  29. characterization of BCRP drug transporter expression and function in AB cells PMID: 23298861
  30. Abcg2 deficiency increases oxidative stress and alters inflammatory response in the brain and exacerbates cognitive/memory deficit in double-tg mice at different developmental stages PMID: 22578166
  31. P-glycoprotein (Mdr1a/1b) and breast cancer resistance protein (Bcrp) decrease the uptake of hydrophobic alkyl triphenylphosphonium cations by the brain. PMID: 23454352
  32. Results indicate that the potency and specificity of sildenafil as an inhibitor of ABCB1 and ABCG2 is not sufficient to warrant further clinical testing of this agent in combination with anticancer drugs. PMID: 23422148
  33. Bcrp plays a significant role in the efflux of (11)C-SC-62807 in liver and kidney PMID: 23287578
  34. It may be concluded that BCRP plays an important role in the intestinal efflux of MED-5 and limits the bioavailability after oral administration of MED-15. PMID: 23333829
  35. Abcg2 modulates cardiac side population cell cycle progression and asymmetric cell division, establishing a mechanistic link between this surface transporter and cardiac progenitor cell function. PMID: 23136123
  36. ABCG2 determines the distribution of genistein phase II metabolites and bioavailability. PMID: 22736306
  37. we developed a positron emission tomography (PET) protocol to visualize Bcrp function at the murine blood-brain barrier PMID: 22828996
  38. Results show that ABCG2 limits the systemic exposure to many different phytoestrogens, by directing their sulfate conjugates for excretion via the feces. PMID: 22707564
  39. Lack of ABCG2 shortens latency of BRCA1-deficient mammary tumors. PMID: 22767648
  40. Localization of BCRP in endocrine organs together with the efficient allosteric inhibition of the efflux pump by steroid hormones are suggestive for a role for BCRP in steroid hormone regulation. PMID: 22581381
  41. The intracellular accumulation of vemurafenib is significantly restricted because of active efflux by P-gp(ABCB1)and BCRP(ABCG2). PMID: 22454535
  42. Assessment of activity, exploratory behavior, and anxiety levels revealed behavioral alterations in Abcb1(0/0) and Abcc1 (0/0) mice, whereas Abcg2(0/0) mice were mostly unaffected. PMID: 22545122
  43. protein abundance and its efflux pump function. The circadian clock-ATF4 pathway appears to enhance the function of BCRP during a specific time window and to modulate intestinal drug absorption PMID: 22396548
  44. Both P-gp and Bcrp1 reduce the brain penetration of erlotinib. PMID: 20963470
  45. PDZK1 plays a pivotal role in the apical localization of BCRP. PMID: 21816982
  46. A direct and conclusive Bcrp1 efflux action on phase II metabolites of these isoflavones in vivo and suggest a possible novel concept for ABCG2/BCRP as part of metabolism-driven efflux transport of these conjugates. PMID: 21828252
  47. the expression levels of ABCG2 transcripts were also significantly decreased in denervated eyes. PMID: 22232434
  48. ATP-binding cassette, G2 subfamily (ABCG2) and BMI-1, predict the transformation of oral leukoplakia to cancer. PMID: 22009787
  49. ABCG2 protects against pressure overload-induced cardiac hypertrophy and heart failure by promoting angiogenesis and antioxidant response. PMID: 22116099
  50. the capacity and regulation of the breast cancer resistance protein (BCRP)-mediated transport in intact human intestinal epithelial monolayers PMID: 22004608

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Apical cell membrane; Multi-pass membrane protein. Mitochondrion membrane; Multi-pass membrane protein.
Protein Families
ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Tissue Specificity
Highly expressed in kidney. Lower expression in liver, colon, heart, spleen, and placenta. Expressed in mammary gland. Expressed in intestinal villi and renal proximal tubules, hepatic bile canalicular membranes, and placental labyrinth cells (at protein
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X