Recombinant Mouse ATP-binding cassette sub-family G member 8 (Abcg8)

Code CSB-CF880562MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Abcg8; ATP-binding cassette sub-family G member 8; Sterolin-2
Species
Mus musculus (Mouse)
Expression Region
1-673
Target Protein Sequence
MAEKTKEETQLWNGTVLQDASQGLQDSLFSSESDNSLYFTYSGQSNTLEVRDLTYQVDIA SQVPWFEQLAQFKIPWRSHSSQDSCELGIRNLSFKVRSGQMLAIIGSSGCGRASLLDVIT GRGHGGKMKSGQIWINGQPSTPQLVRKCVAHVRQHDQLLPNLTVRETLAFIAQMRLPRTF SQAQRDKRVEDVIAELRLRQCANTRVGNTYVRGVSGGERRRVSIGVQLLWNPGILILDEP TSGLDSFTAHNLVTTLSRLAKGNRLVLISLHQPRSDIFRLFDLVLLMTSGTPIYLGAAQQ MVQYFTSIGHPCPRYSNPADFYVDLTSIDRRSKEREVATVEKAQSLAALFLEKVQGFDDF LWKAEAKELNTSTHTVSLTLTQDTDCGTAVELPGMIEQFSTLIRRQISNDFRDLPTLLIH GSEACLMSLIIGFLYYGHGAKQLSFMDTAALLFMIGALIPFNVILDVVSKCHSERSMLYY ELEDGLYTAGPYFFAKILGELPEHCAYVIIYAMPIYWLTNLRPVPELFLLHFLLVWLVVF CCRTMALAASAMLPTFHMSSFFCNALYNSFYLTAGFMINLDNLWIVPAWISKLSFLRWCF SGLMQIQFNGHLYTTQIGNFTFSILGDTMISAMDLNSHPLYAIYLIVIGISYGFLFLYYL SLKLIKQKSIQDW
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
ABCG5 and ABCG8 form an obligate heterodimer that mediates Mg(2+)- and ATP-dependent sterol transport across the cell membrane. Plays an essential role in the selective transport of the dietary cholesterol in and out of the enterocytes and in the selective sterol excretion by the liver into bile. Plays an important role in preventing the accumulation of dietary plant sterols in the body. Required for normal sterol homeostasis. The heterodimer with ABCG5 has ATPase activity.
Gene References into Functions
  1. Alternatively spliced forms for Abcg8 were identified, resulting from a CAG repeat at the intron 1 splice-acceptor site, causing a deletion of a glutamine PMID: 11907139
  2. Although Abcg8 is essential for most diosgenin-induced biliary cholesterol hypersecretion, diosgenin probably does not interact directly with Abcg5/Abcg8, but rather increases cholesterol delivery to the heterodimer. PMID: 15619238
  3. aging significantly enhances cholesterol absorption by suppressing expression of the jejunal and ileal sterol efflux transporter Abcg8 PMID: 16179600
  4. distinct roles for liver and intestinal ABCG5/G8 in modulating sterol metabolism and atherosclerosis in abcg8 transgenic mice. PMID: 17060690
  5. Deletion of the Abcg8 gene alone significantly increases the mass of intestinal cholesterol and sitostanol absorption and reduces but does not eliminate hepatic secretion of cholesterol. PMID: 17393508
  6. ABCG8 mice develop sitosterolemia, a genetic disorder characterized by the accumulation of phytosterols in blood and tissues PMID: 18796403

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Apical cell membrane; Multi-pass membrane protein.
Protein Families
ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Tissue Specificity
Detected in liver and jejunum (at protein level). Expressed in jejunum and ileum and, at lower level, in the liver.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1