Recombinant Mouse ATP-sensitive inward rectifier potassium channel 10 (Kcnj10)-VLPs

Code CSB-MP878111MO
MSDS
Size
Order now
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Kcnj10
Uniprot No.
Research Area
Neuroscience
Alternative Names
(Inward rectifier K(+) channel Kir4.1)(Potassium channel, inwardly rectifying subfamily J member 10)
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
1-379aa
Target Protein Sequence
MTSVAKVYYSQTTQTESRPLVAPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELGPPANHTPCVVQVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length
Tag Info
C-terminal 10xHis-tagged
If you have specified tag type, please tell us and we will check if it's possible to develop.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from PBS, 6% Trehalose, pH 7.4.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex. Repeated freezing and thawing is not recommended.Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant).
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May be responsible for potassium buffering action of glial cells in the brain. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium and cesium. In the kidney, together with KCNJ16, mediates basolateral K(+) recycling in distal tubules; this process is critical for Na(+) reabsorption at the tubules.
Gene References into Functions
  1. Recent progress in exploring the regulation and the function of Kir4.1 in the DCT strongly indicates that Kir4.1plays an important role in initiating the regulation of renal K secretion by targeting NCC and it may serves as a K sensor in the kidney. PMID: 27306796
  2. Results demonstrate that, in addition to astrocytes, oligodendrocytes express both homomeric Kir4.1 and heteromeric Kir4.1/Kir5.1 channels. PMID: 26879293
  3. expressed in the basolateral membrane of the connecting tubule and initial cortical collecting duct and plays a role in generating the negative membrane potential PMID: 26887833
  4. The mechanism by which Cav-1 knockout promotes corneal regrowth is, at least partially, due to the inhibition of Kir4.1 which stimulates EGFR signaling. PMID: 27122158
  5. disruption of cav-1 decreases basolateral K(+) channel activity and depolarizes the cell membrane potential in the DCT1 at least in part by suppressing the stimulatory effect of c-Src on Kcnj10 PMID: 25848073
  6. Data suggest that astroglial Kir4.1 channels are crucially involved in extracellular potassium homeostasis regulating theta rhythmic activity. PMID: 25826753
  7. thyroglobulin trafficking might be modulated by Kir4.1/5.1. PMID: 25612510
  8. Kcnj10 plays a role in Muller glia maturation during retinal development probably through ionic channel activities. PMID: 25684980
  9. Kir.4.1 is expressed in the basolateral membrane of cortical thick ascending limb (cTAL) and that the disruption of Kir.4.1 has no significant effect on the membrane potential of the cTAL limb and Na-K-Cl cotransporter 2 expression PMID: 25834074
  10. Kcnj10 is a main potassium channel expressed in corneal epithelial cells. PMID: 25099735
  11. Kcnj10 is a main contributor to the basolateral K conductance in the early distal convoluted tubule (DCT1) and determines the expression of the apical Na-Cl cotransporter (NCC) in the DCT. PMID: 25071208
  12. TBI affects expression of Kir4.1 and GLT-1 genes in age- and time dependent manner and it may lead to accumulations of more K(+) and glutamate early in the synapse of old mice as compared to adult PMID: 24026668
  13. Ordered disorder of the astrocytic dystrophin-associated protein complex in the norm and pathology. PMID: 24014171
  14. the modulation of tyrosine phosphorylation of KCNJ10 should play a role in regulating membrane transport function in DCT1. PMID: 23873931
  15. Kir4.1 is inhibited in cortical collecting duct cells by dopamine PMID: 23986512
  16. The time course and expression pattern suggests that Kir4.1 and AQP4 channels may play an important role in brain K(+) and water homeostasis in early postnatal weeks after birth and during aging. PMID: 22057895
  17. This study demonistrated that Kir4.1 is expressed not only in glial cells but also in neurons of the mouse vestibular system. PMID: 22546335
  18. This study demonistrated that Kir4.1 channels mediate a depolarization of hippocampal astrocytes under hyperammonemic conditions. PMID: 22431254
  19. The results demonstrated the importance of glial Kir in K(+) spatial buffering and sustaining axonal activity in the optic nerve. PMID: 22290828
  20. The PCR data revealed the existence of two astrocytic subpopulations markedly differing in their gene expression levels for inwardly rectifying K+ channels (Kir4.1), K(2P) channels (TREK-1 and TWIK-1) and Cl- channels (ClC2). PMID: 22253765
  21. Close apposition of AQP4 and inward rectifier potassium-positive (Kir4.1) channels leads to the hypothesis of direct functional interactions between both channels. PMID: 21446052
  22. Kir4.1 K+ channels are regulated by external cations. PMID: 21532341
  23. a strong impact of laminin beta2 and gamma3 subunits on the expression and function of both aquaporin-4 and Kir4.1, two important membrane proteins in Muller cells. PMID: 21283711
  24. The underlying Kir channel subunit that controls glial process swelling is Kir4.1 PMID: 17953658
  25. Kir4.1 channels are involved in the control of acid secretion and may also affect secretory membrane recycling PMID: 21367857
  26. The Kir4.1 channel has a role in setting the membrane potential of glial cells and in maintaining glial cell potassium permeability. PMID: 21106816
  27. These findings support the notion that Kir4.1 is the principal Kir channel type in Sensory ganglion cells. Therefore Kir4.1 emerges as a key regulator of sensory ganglion cell function and possibly neuronal excitability in sensory ganglia. PMID: 20074622
  28. Kir4.1 proteins are weakly rectifying potassium channels expressed predominantly in retinal glial cells endfoot membranes facing a basal lamina. PMID: 12203395
  29. Crucial for normal development of cochlea and hearing. In stria vascularis, helps generate cochlear endolymph. In spiral and vestibular ganglia, helps support spiral and vestibular ganglion neurons and their projecting axons. PMID: 12618319
  30. Kir4.1 is localized in glial cells as seen by its association with the DGC through a PDZ domain-mediated interaction with alpha-syntrophin PMID: 15102837
  31. Kcnj10 exhibits a potentially important polymorphism with regard to fundamental aspects of seizure susceptibility. PMID: 15112102
  32. Kir4.1/5.1 and Kir4.1 expression appeared to occur only in astrocytes, specifically in the membrane domains facing the pia mater and blood vessels or in the processes surrounding synapses. PMID: 15310750
  33. ototoxicity of L-alpha-difluoromethylornithine may be mediated by alteration of the inward rectification of Kir4.1 channels, resulting in a marked reduction in endocochlear potential PMID: 15718247
  34. Kir4.1 and aquaporin-4 are associated with dystrophin-glycoprotein complex proteins in rat retina PMID: 16206160
  35. Hence, Kir, and in particular Kir4.1, are key regulators of glial functions, which in turn determine neuronal excitability and axonal conduction. PMID: 16563220
  36. Results indicate that Kir4.1 channels are the molecular substrate for the observed Ca2+ influx in astrocytes under conditions of low external K+-concentration. PMID: 17284334
  37. Evidence against functionally significant aquaporin 4 modulation of Muller cell Kir4.1 potassium channel function in retinal Muller cells. PMID: 17525153
  38. Kir4.1 causes a membrane hyperpolarization that is sufficient to account for the growth attenuation, which in turn induces cell maturation characterized by a shift of the cells from G2/M into G0/G1. PMID: 17876807
  39. Free radical stress provides a link between loss of pendrin and loss of Kcnj10 in Slc26a4(-/-) mice and possibly in human patients suffering from Pendred syndrome. PMID: 17959752
  40. Expression of the weakly inwardly rectifying K+ channel Kir4.1 in the respiratory network and possible functions for neuronal activity. PMID: 18085256
  41. Muller glial cells respond to excessive light with an alteration in the localization of Kir4.1 protein; this alteration is thought to be a response to the edema in the outer retina and may support the resolution of edema. PMID: 18328627
  42. the Kir4.1/Kir5.1 channel is a major component of the K(+) conductance in the basolateral membrane of mouse cortical collecting duct principal cells PMID: 18367659
  43. Genotype distributions of the Kcnj10 Thr262Ser SNP were different between low- and high-ethanol drinkers. PMID: 19053975
  44. These results suggest differential expression of Kir4.1 in glia and that this channel likely underlies the resting K(+) conductance in passive and complex astrocytes. PMID: 19382212
  45. mutations in the inwardly rectifying K(+) channel gene KCNJ10 are associated with nonsyndromic hearing loss in carriers of SLC26A4 mutations with an EVA/PS phenotype. PMID: 19426954
  46. our findings demonstrate that Kir4.1 constitutes the pivotal K+ channel subunit and that superposition of currents through Kir4.1 and TREK channels underlies the "passive" current pattern of hippocampal astrocytes PMID: 19515915

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein. Basolateral cell membrane.
Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ10 subfamily
Tissue Specificity
Widely expressed in adult brain, including in the neocortex, the stratum pyrimadale of the hippocampus and the piriform cortex. Expressed by cultured astrocytes and also by cocultured cortical neurons (at protein level).
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*