Product Details

Target Names

Aqp1

Uniprot No.

Q02013

Alternative Names

Aqp1; Aquaporin-1; AQP-1; Aquaporin-CHIP; Delayed early response protein 2; DER2; Water channel protein for red blood cells and kidney proximal tubule

Species

Mus musculus (Mouse)

Source

in vitro E.coli expression system

Expression Region

1-269

Target Protein Sequence

MASEIKKKLFWRAVVAEFLAMTLFVFISIGSALGFNYPLERNQTLVQDNVKVSLAFGLSIATLAQSVGHISGAHLNPAVTLGLLLSCQISILRAVMYIIAQCVGAIVATAILSGITSSLVDNSLGRNDLAHGVNSGQGLGIEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGHLLAIDYTGCGINPARSFGSAVLTRNFSNHWIFWVGPFIGGALAVLIYDFILAPRSSDFTDRMKVWTSGQVEEYDLDADDINSRVEMKPK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Protein Length

Full Length

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.

Gene References into Functions

AQP1 may play an important role in the homeostasis of maternal-fetal fluid at late gestation days. PMID: 29626438
AQP1 is expressed in atherosclerotic lesion neovasculature in human and mouse arteries and AQP1 deficiency augments lesion development in angiotensin II-promoted atherosclerosis in mice. PMID: 28129470
AQP0 modulates GJs in the presence of BF proteins to maintain lens transparency and homeostasis. PMID: 29196765
Our results demonstrate that Aqp1 is maternally expressed in the placenta, and that its deficiency resulted in placental abnormalities in the mouse. Aqp1 may have a specific inhibitory role in mouse placental development. PMID: 27307076
Data show that overexpression of manganese superoxide dismutase (MnSOD) increased the expression of aquaporin-1 (AQP1) PMID: 27383386
AQP1 deficiency delays long-term ischemia-reperfusion resolution, partly through repressing angiogenesis mediated by destabilizing HIF-2alpha. PMID: 26649797
The results demonstrate that the descending thin limb (DTL) of the intermediate loop is composed of type I epithelium and expresses both AQP1. The functional role of the DTL of the intermediate loop may be distinct from the short or long loops. PMID: 27091563
data suggest an important functional role of AQP1 in the pathobiology of hypoxia-induced pulmonary hypertension PMID: 28409279
Angiotensinogen-mediated downregulation of aquaporin 1 and Nrf2 signalling may play an important role in intrarenal renin-angiotensin system-induced hypertension and kidney injury. PMID: 27638854
The results suggest an important role of AQP1-mediated plasma membrane water permeability in maternal-fetal fluid balance PMID: 26014508
AQP1 deficiency reduced microvascular permeability via the stabilization of HIF-1alpha levels in endothelial cells and decreased cellular apoptosis following MI. PMID: 26348407
These data provide the first direct experimental evidence for the functional relevance of endothelial AQP1 to the fluid transport in peritoneal dialysis PMID: 26760974
Reduction of cardiac aquaporin 1 and angiogenic factor expression level might be associated with high-salt-induced hypertension and cardiac injuries in mice, and could be ameliorated by angiotensin II receptor blocker treatment. PMID: 25659450
the presence of AQP1 modifies the expression of key cell cycle proteins apparently related to increases in cell proliferation PMID: 26081645
AQP1 oppositely regulates macrophage migration, depending on stimulation or not by LPS. PMID: 25719758
The pro-inflammatory cytokine, interferon-gamma may contribute to diarrhea associated with intestinal inflammation in part through regulation of the epithelial aquaporin-1 water channel via a non-classical JAK/STAT receptor signalling pathway. PMID: 25793528
Aqp1 activation by tubular fluid shear stress, serving to maintain glomerulotubular balance. PMID: 25270072
implicate AQP1 as a novel determinant in renal cyst development that may involve inhibition of Wnt signaling by an AQP1-macromolecular signaling complex PMID: 25573755
This study demonstrated that there was a temporal relationship with an increased expression of AQP1 following injury sustained to the sciatic nerve that was significantly observed in dorsal root ganglia and spinal cord. PMID: 25119150
Rotavirus diarrhea is associated with the downregulation of AQP1, -4, and -8 expression. PMID: 25160756
Aquaporin-1 water permeability is a novel determinant of dorsal root ganglion axonal regeneration. PMID: 25585012
Lung AQP1 and AQP5 expression were significantly decreased in mice with acute lung injury together with increased inflammatory reaction and apoptosis of alveolar epithelial and vascular endothelial cells PMID: 24879973
We conclude that AQP1 is not necessary for acutely stimulated renin secretion in vivo and from isolated perfused kidneys PMID: 25339696
a new function of AQP in the inflammatory process PMID: 24700466
A critical role of AQP1 in placental and fetal growth and maternal-fetal fluid homeostasis. PMID: 23808411
knockout mouse studies showed water influx into the CSF is regulated by AQP-4, and not by AQP-1 PMID: 24231830
Inhibition of AQP1 dependent angiogenesis impairs tumor growth in a mouse model of melanoma. PMID: 23197380
HIF-1alpha participates in the hypoxic induction of the AQP1 gene PMID: 23948641
results implicate AQP1 as an important determinant of tumor angiogenesis and, hence, as a potential drug target for adjuvant therapy of solid tumors PMID: 24334548
The capacity of non-AQP1-dependent transcellular proximal fluid reabsorption (PFR) is sufficient to be maintained in AQP1- and claudin-2-doubly deficient knockout mice. PMID: 24049145
Silicic acid in drinking water prevents age-related alterations in the endothelium-dependent vascular relaxation modulating eNOS and AQP1 expression in experimental mice. PMID: 23177919
Cardioplegia, ischemia and hypoxia decrease AQP1 mRNA as well as total protein expression and glycosylation, possibly regulated by miR-214. PMID: 23238222
Data indicate selective expression of aquaporins 3 and 8 in primitive erythroblasts and aquaporins 1 and 9 in adult definitive erythroblasts. PMID: 23243273
As in the brain, expression of AQP1 and -4 in the heart is influenced by changes in plasma osmolality. PMID: 22820194
Selective expression of AQP1 in the trigeminal neurons innervating the oral mucosa indicates an involvement of AQP1 in oral sensory transduction. PMID: 23029502
Relaxin regulates hyaluronan synthesis and aquaporins in the cervix of late pregnant mice PMID: 23087172
Elevated expressions of AQP1 mRNA were associated with increased volume of malignant pleural effusion. PMID: 21519870
results indicate that AQP1 and AQP5 are closely related to pulmonary edema but not to eosinophil infiltration or mucus secretion during asthma. PMID: 22226856
AQP1 abundance is 42.7% lower in the choroid plexus epithelium of solute carrier family 4 sodium bicarbonate cotransporter-like (Slc4a10)-deficient mice. PMID: 22357733
The activation of Aqp1 promoter by hypoxia is complex and multifactorial and suggest that besides HIF-1alpha other transcription factors might contribute to this regulatory process. PMID: 22174795
The persistent high urine volume after arginine vasopressin administration was traced to a reduction in aquaporin-1 expression in the kidney of LXRbeta(-/-) mice. PMID: 22323586
A pretranslational regulation occurs in iodoacetamide-induced AQP1 expression in mouse fibroblasts, and the up-regulated AQP1 accumulation is characterized by mitochondria-related energy dependence. PMID: 21269951
AQP1 promotes angiogenesis, fibrosis, and portal hypertension after bile duct ligation and is regulated by osmotically sensitive miRNAs. PMID: 21854740
The AQP1 and AQP3 genes were expressed in the secretary epithelia of the mouse prostate tissue, which suggests that AQP1 and AQP3 may play an important role in the secretion of prostatic fluid. PMID: 21735643
AQP-1 may reflect the status of aged IVDs and have a potential role in reflecting the adaptability of NP cells under different adverse ECM environments in aging degenerated IVDs. PMID: 21451971
increased water permeability through AQP1 does not compensate for loss of AQP0 expression in TgAQP1(+/+)/AQP0(-/-) mice. Fiber cell AQP0 expression is required to maintain their organization, which is a requisite for lens transparency PMID: 21511033
An increased level of Aqp4 protein, but not Aqp1, protein is demonstrated in a membrane-enriched fraction of cortical brain tissue, obtained from mice induced with acute liver injury, hyperammonemia and brain edema. PMID: 20938728
The reduced ventricular size in AQP1-deficient mice following kaolin-induced hydrocephalus suggests AQP1 inhibition or down-regulation as a potential adjunctive treatment for hydrocephalus. PMID: 21040788
AQP1 was localized on the cell processes of the fibrocytes in the endolymphatic sac. PMID: 17633275
Data suggest that aquaporin 1 expression represents an important distinguishing characteristic of olfactory ensheathing glia, which may impart unique function to these glia. PMID: 20853510

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Protein Families

MIP/aquaporin (TC 1.A.8) family

Tissue Specificity

Detected in erythrocytes (at protein level). In the kidney, expressed on luminal and basal borders of proximal tubules and in the thin limb of Henle's loop (at protein level).

Database Links

KEGG: mmu:11826

STRING: 10090.ENSMUSP00000004774

UniGene: Mm.18625