Recombinant Mouse Aquaporin-1(Aqp1)

Code CSB-CF586908MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q02013
Species Mus musculus (Mouse)
Sequence MASEIKKKLFWRAVVAEFLAMTLFVFISIGSALGFNYPLERNQTLVQDNVKVSLAFGLSIATLAQSVGHISGAHLNPAVTLGLLLSCQISILRAVMYIIAQCVGAIVATAILSGITSSLVDNSLGRNDLAHGVNSGQGLGIEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGHLLAIDYTGCGINPARSFGSAVLTRNFSNHWIFWVGPFIGGALAVLIYDFILAPRSSDFTDRMKVWTSGQVEEYDLDADDINSRVEMKPK
Source in vitro E.coli expression system
Gene Names Aqp1
Expression Region 1-269
Protein Description Full Length
Still Have Questions? Leave a Message or Start an on-line Chat
Function Forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families MIP/aquaporin (TC 1.A.8) family
Tissue Specificity Detected in erythrocytes (at protein level). Erythrocytes and renal tubules.
Database Links

KEGG: mmu:11826

STRING: 10090.ENSMUSP00000004774

UniGene: Mm.18625

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.