Recombinant Mouse Aquaporin-3 (Aqp3)

Code CSB-CF823166MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Aqp3
Uniprot No.
Alternative Names
Aqp3; Aquaporin-3; AQP-3; Aquaglyceroporin-3
Species
Mus musculus (Mouse)
Expression Region
1-292
Target Protein Sequence
MGRQKELMNRCGEMLHIRYRLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTINLAFGFAVTLGILVAGQVSGAHLNPAVTFAMCFLAREPWIKLPIYALAQTLGAFLGAGIVFGLYYDAIWAFANNELFVSGPNGTAGIFATYPSGHLDMVNGFFDQFIGTAALIVCVLAIVDPYNNPVPRGLEAFTVGLVVLVIGTSMGFNSGYAVNPARDFGPRLFTALAGWGSEVFTTGRHWWWVPIVSPLLGSIAGVFVYQLMIGCHLEQPPPSTEEENVKLAHMKHKEQI
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Water channel required to promote glycerol permeability and water transport across cell membranes. Acts as a glycerol transporter in skin and plays an important role in regulating SC (stratum corneum) and epidermal glycerol content. Involved in skin hydration, wound healing, and tumorigenesis. Provides kidney medullary collecting duct with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient. Slightly permeable to urea and may function as a water and urea exit mechanism in antidiuresis in collecting duct cells. It may play an important role in gastrointestinal tract water transport and in glycerol metabolism.
Gene References into Functions
  1. results support a novel role for AQP3 in modulating renal injury and suggest the mechanisms involved in protection against hypoxic injury. PMID: 28344130
  2. The results of this study suggest that NAR relieves Lop-induced constipation by increasing the levels of interstitial cells of Cajal markers (c-Kit and SCF), as well as AQP3. Thus, NAR may be effective as a candidate in patients suffering from lifestyle-induced constipation. PMID: 29207043
  3. Increased expression of AQP3 and AQP10 in murine skin with the concomitant presence of an inflammatory stimulus (IMQ) and contact with detergent-containing water increases skin acanthosis and affects the biology of keratinocytes. PMID: 28111811
  4. AQP3(-/-) mice showed impaired healing of superficial wounds in the colon and impaired mucosal innate immune responses against Citrobacter rodentium infection. PMID: 28049834
  5. These results imply a critical role of AQP3 in asthma. PMID: 27165276
  6. This study found that both the airway epithelial cells of AQP3-knockout mice and AQP3-knockdown HBECs exhibited an obviously impaired self-healing capacity with defective epithelial cell migration through AQP3-facilitated glycerol transport. PMID: 27524635
  7. Decreased glycerol efflux from the skeletal muscles in AQP3 knockout mice may result in low exercise capacity. PMID: 27138166
  8. treatment of human HepG2 cells with TCDD also increased the expression of AQP3 mRNA and protein PMID: 26454884
  9. AQP3-facilitated H2O2 transport is required for NF-kappaB activation in keratinocytes in the development of psoriasis. PMID: 26100668
  10. Studied the effect of the total tannins extract of rhubarb on expression od aquaporin 2 and auqaporin 3 in diarrhoea mice. PMID: 25215286
  11. AQP3 has a pro-differentiative role in epidermal keratinocytes and PLD2 activity is necessary for this effect. PMID: 25233074
  12. analysis of the molecular link between the circadian clock and AQP3 function in mouse dorsal skin and HaCaT cells PMID: 24418925
  13. In a mouse model of intestinal ischemia the level of miR-874 expression was inversely related to AQP3 protein expression. PMID: 24462679
  14. Data indicate selective expression of aquaporins 3 and 8 in primitive erythroblasts and aquaporins 1 and 9 in adult definitive erythroblasts. PMID: 23243273
  15. We therefore suggest that AQP3-mediated H(2)O(2) uptake is required for chemokine-dependent T cell migration in sufficient immune response. PMID: 22927550
  16. It was concluded that acyl-CoA binding protein via aquaporin 3 is necessary for intact urine concentrating ability through efflux over the basolateral membrane of the collecting duct. PMID: 22237802
  17. The results of this study suggest that Gypsum fibrosum plays an important role in the increased levels of cutaneous AQP3 expression enhanced by Byakkokaninjinto. PMID: 22138657
  18. AQP3 as a novel determinant in macrophage immune function by a cellular mechanism involving facilitated water and glycerol transport, and consequent phagocytic and migration activity PMID: 21865318
  19. PPARgamma activation stimulates AQP3 expression, providing an additional mechanism by which PPAR activators regulate epidermal function. PMID: 21457357
  20. These results suggest that AQP3 may play a role in modulating dendritic cell population and migration PMID: 21871666
  21. The AQP1 and AQP3 genes were expressed in the secretary epithelia of the mouse prostate tissue, which suggests that AQP1 and AQP3 may play an important role in the secretion of prostatic fluid. PMID: 21735643
  22. aquaporin 3 is an essential membrane pathway for sperm regulatory volume decrease that balances the "trade-off" between sperm motility and cell swelling upon physiological hypotonicity PMID: 21135872
  23. The results indicate that AQP3 is certainly needed for the acquisition of immature oocytes' full growing potential within antral follicles. PMID: 20509986
  24. involvement of AQP3 in epidermal hyperplasia by a mechanism involving upregulated AQP3 expression and consequent enhancement of keratinocyte proliferation PMID: 21191421
  25. establish that AQP3 is required for Nox-derived H(2)O(2) signaling upon growth factor stimulation PMID: 20724658
  26. Impaired stratum corneum hydration in mice lacking epidermal water channel aquaporin-3. PMID: 11880378
  27. first functional evidence for physiologically important glycerol transport by an aquaporin PMID: 12270942
  28. Phosphatidylglycerol, as a bioactive lipid, could potentially mediate the effects of the aquaporin 3-phospholipase D2 signaling module, with aquaporin 3 as a modulatory unit, in the regulation of keratinocyte function. PMID: 14675200
  29. upregulation of the UT-A2 urea transporter and the aquaporin 2 (AQP2) and AQP3 water channel transcripts but no change in other urea transporters or AQP in urea transporter B null mice PMID: 15100356
  30. Aquaporin-1, -3, and -5 dependent water-transporting properties of cornea and conjunctiva. PMID: 15557451
  31. AQP3 was detected in the alveolar epithelium and duct system. PMID: 15844003
  32. Mechanistic analysis of the altered skin phenotype in AQP3 deficiency suggested that the glycerol rather than the water transporting function of AQP3 is important in skin physiology PMID: 15966863
  33. an NH2-terminal sorting signal mediates the basolateral targeting of AQP3 PMID: 16135541
  34. The results suggest a novel role for AQP3 in non-urea solute concentration in the urine. PMID: 16525162
  35. Study demonstrates that during Enterobacterial infection, AQP2 and AQP3 are mislocalized from their normal location along cell membranes to the cell cytoplasm; his change correlates with the diarrhoea-like phenotype present in infected mice. PMID: 16889624
  36. AQP3 supplies PLD2 with glycerol for synthesizing PG, a lipid signal that promotes early keratinocyte differentiation PMID: 17597824
  37. AQP3 may thus be an important determinant in skin tumorigenesis and hence a novel target for tumor prevention and therapy PMID: 17967887
  38. Provide evidence for involvement of AQP3-facilitated water transport in epidermal cell migration and for AQP3-facilitated glycerol transport in epidermal cell proliferation. PMID: 17968524
  39. AQP3 might play an important role in controlling oocyte quality and a low in vitro fertilization rate of controlled ovarian hyperstimulation mice might, in part, result from reduced AQP3 expression and water permeability in mouse oocytes. PMID: 18209479
  40. There is little influence of AQP3 on keratinocyte differentiation, but there is support for the proposed involvement of AQP3-facilitated cell proliferation. PMID: 19184071
  41. aquaporins are common targets of gene expression in both allergen and IL-13 induced mouse models of asthma PMID: 19237298
  42. Blockade of MAPK14/11 negated the increase in Aqp 3 and 9 mRNA levels, whereas culture in a MAPK8 blocker did not in preimplantation embryo PMID: 19258345

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein.
Protein Families
MIP/aquaporin (TC 1.A.8) family
Tissue Specificity
Detected in principal cells in collecting ducts in kidney medulla (at protein level). Renal medulla and colon. Predominantly in the inner medulla. Expressed in basal layer of epidermal keratinocytes.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1