Recombinant Mouse Beta-3 adrenergic receptor (Adrb3)

Code CSB-CF001393MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Adrb3; Adrb3r; B3bar; Beta-3 adrenergic receptor; Beta-3 adrenoreceptor; Beta-3 adrenoceptor
Species
Mus musculus (Mouse)
Expression Region
1-400
Target Protein Sequence
MAPWPHRNGSLALWSDAPTLDPSAANTSGLPGVPWAAALAGALLALATVGGNLLVIIAIA RTPRLQTITNVFVTSLAAADLVVGLLVMPPGATLALTGHWPLGETGCELWTSVDVLCVTA SIETLCALAVDRYLAVTNPLRYGTLVTKRRARAAVVLVWIVSAAVSFAPIMSQWWRVGAD AEAQECHSNPRCCSFASNMPYALLSSSVSFYLPLLVMLFVYARVFVVAKRQRHLLRRELG RFSPEESPPSPSRSPSPATGGTPAAPDGVPPCGRRPARLLPLREHRALRTLGLIMGIFSL CWLPFFLANVLRALAGPSLVPSGVFIALNWLGYANSAFNPVIYCRSPDFRDAFRRLLCSY GGRGPEEPRAVTFPASPVEARQSPPLNRFDGYEGARPFPT
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. Beta-3 is involved in the regulation of lipolysis and thermogenesis.
Gene References into Functions
  1. In contrast, Adrb3 activation stimulates mature white adipocytes to convert into beige adipocytes. PMID: 29019320
  2. Specific visible radiation facilitates lipolysis in mature 3T3-L1 adipocytes via rhodopsin-dependent beta3-adrenergic signaling. PMID: 28483278
  3. beta3-Adrenergic Regulation of EPC Features Through Manipulation of the Bone Marrow MSC Niche. PMID: 28513874
  4. Findings are of potential physiologic importance as they uncover the antidiuretic effect of beta3-AR stimulation in the kidney. PMID: 27206969
  5. aerobic exercise training could improve cardiac systolic function and alleviate LV chamber dilation, cardiac fibrosis and hypertrophy in heart failure mice. The mechanism responsible for the protective effects of aerobic exercise is associated with the activation of the beta3-AR-nNOS-NO pathway. PMID: 28622359
  6. Data (including data from studies in knockout mice) suggest that Adrb3 is dispensable for browning of adipose tissue; here, no differences was observed in cold-induced thermogenic gene expression in brown, white, or beige adipose tissues due to absence of Adrb3; irrespective of duration of cold exposure or sex of mice, no effect of absence of Adrb3 was observed. PMID: 28223294
  7. injection of a b3-adrenergic receptor (b3-AR) agonist for continuous 5 days increased the number of Ki67-positive brown adipocytes even at Day 1 but not that of SV cells. In addition, the b3-AR antagonist, but not b1-AR antagonist, attenuated the cold exposure-induced increase in the number of Ki67-positive brown adipocytes PMID: 27846311
  8. ARbeta3 disruption does not affect brown adipose tissue thermogenesis but increases susceptibility to diet-induced obesity by dampening white adipose tissue lipolytic response to adrenergic stimulation. PMID: 27672060
  9. RIP140 has a unique role in the acute effect of beta-3 adrenergic receptor activation. PMID: 28322782
  10. Data show that fish oil intake increased oxygen consumption and rectal temperature, with concomitant upregulation of mitochondrial uncoupling protein 1 (UCP1) and beta3 adrenergic receptor (beta3AR). PMID: 26673120
  11. ADRB3 in perivascular adipose tissue contributes to vascular function in the progression of hypertension. PMID: 26910302
  12. Theseresultssuggestthat beta3-adrenoceptors are present in colonic Interstitial Cells of Cajal and may play a role in regulating gastrointestinal motility by the inhibition of pacemaker potentials. PMID: 25725113
  13. role of beta3-adrenoreceptor in myocardial infarction injury via eNOS and nNOS activation PMID: 24911015
  14. Nitric oxide is a downstream effector of beta3 adrenergic receptors which modulates melanoma cell proliferation. PMID: 24599317
  15. A single-dose administration of beta3AR agonist before reperfusion decreased infarct size and resulted in a consistent and long-term improvement in cardiac function in mouse model of myocardial ischemia reperfusion injury. PMID: 24951958
  16. Data suggest that Adrb3 is involved in regulation of pancreatic islet blood flow; hyperlipidemia (triglycerides and free fatty acids) is associated with vagus nerve-dependent increase in pancreatic/islet blood flow and up-regulation of insulin secretion. PMID: 25139049
  17. Beta3 adrenergic receptor activation lowers blood lipids and glucose which attenuates atherosclerotic plaque formation. PMID: 23892270
  18. activation of beta-adrenoceptor reduce the plaque area in the thoracic aorta and play an important anti-atherosclerotic role by regulating lipid metabolism disorders and the SR-B1 signal transduction pathway PMID: 23911886
  19. Beta3-adrenergic receptors modulate vascular endothelial growth factor release in response to hypoxia through the nitric oxide pathway in mouse retinal explants PMID: 23283573
  20. expression and function of beta(3)-adrenoceptors and beta(2)-adrenoceptors in mouse uterus PMID: 23219791
  21. beta(3)-adrenergic stimulation acts through up-regulation of E-selectin in adipose tissue endothelial cells to induce neutrophil infiltration PMID: 23235150
  22. Results suggest that the effects of zinc-alpha2-glycoprotein (ZAG) on body weight and insulin sensitivity in ob/ob mice are manifested through beta-adrenoreceptor (beta-AR) beta-3AR or possibly a beta2-AR. PMID: 22227600
  23. Brown adipocytes that are induced by beta3-adrenergic receptor activation in abdominal white adipose tissue arise from the proliferation and differentiation of cells expressing PDGFRalpha, CD34, and Sca-1. PMID: 22482730
  24. The function of M2 MR is substituted by beta3-AR and that these effects are mediated via adenylyl cyclase rather than NOS. PMID: 22222438
  25. Diminished beta3AR signaling may be the critical element to explain the direct effects of leptin on the myocardium and suggest that this work reveals a key feature in the role of leptin in obesity-related cardiac hypertrophy and heart failure. PMID: 21772246
  26. interaction of the beta(3a)-AR with caveolin inhibits coupling to Galpha(i/o) proteins and suggest that signaling is modulated by a raft-enriched complex containing the beta(3a)-AR, caveolin-1, Galpha(s), and adenylyl cyclase. PMID: 22535965
  27. NT-PGC-1alpha protein is sufficient to link AR beta 3 activation to transcriptional and physiological components of thermogenesis. PMID: 22282499
  28. High (stress) levels of epinephrine directly compromise the activity of neonatal mouse skin fibroblasts through the activation of beta1-, beta2- and beta3-adrenoceptors, but not through alpha1- and alpha2-adrenoceptors. PMID: 21366703
  29. b3-adrenoceptors are present in mouse astrocytes and activation of b2- and b3-adrenoceptors increases glucose uptake PMID: 21138422
  30. negative inotropy and heart hypertrophy occur in total adrenergic beta receptor deficiency PMID: 20406048
  31. Data show that both the mRNA and protein levels of beta2- and beta3-adrenergic receptors were up-regulated following cAMP/PKA-mediated adipogenesis of mouse bone marrow derived mesenchymal stem cells. PMID: 20363288
  32. genetic variants, including Ala/Ala of SCYA11 (eotaxin) Ala23Thr, Cys/Cys or Cys/Ser of PON2 (paraoxonase 2) Ser311Cys and Arg/Arg of ADRB3 (beta3-adrenergic receptor) Trp64Arg, were independently associated with incident cardiac end-point. PMID: 20536507
  33. Data show that caveolin-1 ablation affected neither the G-protein coupled LPA receptor signaling to Erk1/2, nor the receptor tyrosine kinases PDGF- or EGF-receptor signaling to Erk1/2. PMID: 20381543
  34. Both beta2- and beta3-AR are involved in MSC osteogenesis, with beta2-AR being dominant. PMID: 20138019
  35. Data suggest that glucocorticoids have opposing effects on beta(3)-adrenergic receptor gene expression: they rapidly and directly inhibit transcription but also induce a rapidly turned-over protein that stimulates gene transcription. PMID: 11997176
  36. betaAR signaling required for diet-induced thermogenesis and obesity resistance. PMID: 12161655
  37. role in obesity and cold sensitivity and response to fasting PMID: 12387862
  38. nuclear BAR-3 may have a role in eating behavior PMID: 12943691
  39. adrenergic stimulation, through beta3-adrenergic receptors/cAMP/protein kinase A, recruits a PI3K pathway stimulating conventional and novel PKCs, which mediate glucose uptake in brown adipocytes PMID: 14551227
  40. vimentin plays an essential role in the signal transduction pathway from beta3AR to the activation ERK and its contribution to lipolysis PMID: 17251187
  41. beta3-AR are upregulated during sepsis in the human myocardium and by cytokines in murine cardiomyocytes, where they mediate an increased negative inotropic response to beta3 agonists. PMID: 17999941
  42. Here we describe an atypical state of the beta(3)-adrenoceptor that exists endogenously in adipose tissue PMID: 18031735
  43. Report the effects of beta(3)-adrenoceptor agonist CL-316,243 on adiponectin, adiponectin receptors and tumor necrosis factor-alpha expressions in adipose tissues of obese diabetic KKAy mice. PMID: 18304529
  44. Norepinephrine signaling via beta(3) adrenergic receptors presumably in brown fat is the first neurotransmitter-receptor system identified that is required for normal recovery from torpor. PMID: 19107190
  45. while stimulation of the beta(3)AR leads to activation of CRE-dependent transcription, there are several pathways that converge at the level of CRE-response element activation, and for IL-6 this activation is mediated by p38 and PKC but not PKA pathways. PMID: 19477016
  46. Folic acid consumption has significant modulatory effects on beta-ARs protein expression and lipolysis. PMID: 19596833
  47. Functional beta(3)-adrenoceptors appear to be present in mouse urinary bladder. PMID: 19619525
  48. data suggest a cardioprotective role for the beta3-AR in modulating oxidative stress and adverse remodeling in the failing heart. PMID: 19766235

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRB3 sub-subfamily
Tissue Specificity
White and brown adipose tissues, and digestive tract. Isoform B highest in brain.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1