Recombinant Mouse C3a anaphylatoxin chemotactic receptor (C3ar1)

Code CSB-CF003889MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
C3ar1; C3r1; C3a anaphylatoxin chemotactic receptor; C3AR; C3a-R; Complement component 3a receptor 1
Species
Mus musculus (Mouse)
Expression Region
1-477
Target Protein Sequence
MESFDADTNSTDLHSRPLFQPQDIASMVILGLTCLLGLLGNGLVLWVAGVKMKTTVNTVW FLHLTLADFLCCLSLPFSLAHLILQGHWPYGLFLCKLIPSIIILNMFASVFLLTAISLDR CLIVHKPIWCQNHRNVRTAFAICGCVWVVAFVMCVPVFVYRDLFIMDNRSICRYNFDSSR SYDYWDYVYKLSLPESNSTDNSTAQLTGHMNDRSAPSSVQARDYFWTVTTALQSQPFLTS PEDSFSLDSANQQPHYGGKPPNVLTAAVPSGFPVEDRKSNTLNADAFLSAHTELFPTASS GHLYPYDFQGDYVDQFTYDNHVPTPLMAITITRLVVGFLVPFFIMVICYSLIVFRMRKTN FTKSRNKTFRVAVAVVTVFFICWTPYHLVGVLLLITDPESSLGEAVMSWDHMSIALASAN SCFNPFLYALLGKDFRKKARQSIKGILEAAFSEELTHSTNCTQDKASSKRNNMSTDV
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for the chemotactic and inflammatory peptide anaphylatoxin C3a. This receptor stimulates chemotaxis, granule enzyme release and superoxide anion production.
Gene References into Functions
  1. Development of burn-induced mechanical allodynia, thermal allodynia, weight bearing changes and edema was assessed in C3aR(-/-), C5aR1(-/-) and C5aR2(-/-) mice and compared to their wild type controls over three days. Burn-induced mechanical allodynia, thermal allodynia and weight bearing changes developed normally C3aR(-/-), C5aR1(-/-) and C5aR2(-/-) mice. PMID: 29274925
  2. Complement component 3a receptor 1 role in the lung cancer progression. PMID: 29118090
  3. The complement 3a receptor (C3aR1) participates in microglial signaling under pathological conditions and was recently shown to be activated by the neuropeptide TLQP-21. PMID: 28850719
  4. whilst the C3aR modulates some elements of disease pathogenesis, overall it is not critical in effector responses and glomerular injury caused by autoimmunity to MPO PMID: 29315316
  5. study provided detailed insights into the C3aR expression pattern in immune and stromal cells under steady-state conditions PMID: 28626064
  6. proposal that C3aR activation alters the tumor inflammatory milieu, thereby promoting tumor growth PMID: 27183625
  7. increased circulating lipopolysaccharide induces upregulation of complement C3a receptor on neutrophils and activation of the complement cascade. PMID: 26996437
  8. showed that C3a receptor/C5a receptor-deficient mice developed much less severe uveitis than did control mice using all retinal examination methods PMID: 26394814
  9. these findings suggest a critical role for C3a through autocrine/paracrine induction of C3aR in the pathogenesis of cigarette smoke-induced sterile inflammation and provide new therapeutic targets for the treatment of emphysema. PMID: 25465103
  10. C3a/C3aR signaling during host immune response suppresses Fas expression and caspase-3 activity while increasing Bcl-2 proto-oncogene protein expression, providing protection to myeloid and lymphoid cells against L. monocytogenes-induced apoptosis. PMID: 24981453
  11. This study indicated that C3a and C5a-mediated functions are not critical to the development of experimental autoimmune uveitis. PMID: 24035596
  12. The binding of TLQP-21 to C3AR1 not only has effects on signaling but also modulates cellular functions PMID: 23940034
  13. C3a receptor promotes viral containment in mice inoculated with vaccinia virus at sites of allergic skin inflammation. PMID: 23684067
  14. The role of the anaphylatoxin C3a receptor in acute dextran sulfate sodium-induced colitis in mice, was investigated. PMID: 23638016
  15. The receptor for complement component C3a mediates protection from intestinal ischemia-reperfusion injuries by inhibiting neutrophil mobilization. PMID: 23696668
  16. nT reg cells express C3aR and C5aR, and signaling through these receptors inhibits nT reg cell function. PMID: 23382542
  17. Absence of signaling into CD4 cells via C3aR and C5aR enables autoinductive TGF-beta1 signaling and induction of Foxp3+ regulatory T cells. PMID: 23263555
  18. Complement C3a receptor activation contributes to the pathogenesis of preeclampsia. PMID: 22868393
  19. Clinical disease activity in C3aR(-/-), C5aR(-/-), and C6-deficient (C6-def) mice was decreased by 52, 94, and 65%, respectively, as compared with wild-type mice. PMID: 22205026
  20. might participate in conjunction with other complement effector functions down-stream of C3/C3b in the protection of Th2 induced allergic contact dermatitis PMID: 22151392
  21. distinct roles of C3a and C5a receptor signaling in complement-induced tubulointerstitial injury PMID: 21677637
  22. These results confirm an important role for C5 cleavage in murine MI/R injury. PMID: 20930931
  23. C3a plays an important role in CNS lupus, signaling through its receptor C3aR. PMID: 19900981
  24. It remains unclear how the changes in these disease parameters contribute to the loss of the protective effect seen in C3aR(-/-) mice, however our data indicate a level of cross-modulation between the C3aR and C5aR during EAE. PMID: 19850104
  25. This increased expression at late time points after occlusion is most likely the result of massive infiltration of leukocytes expressing the receptors. PMID: 11948810
  26. The complement anaphylatoxin C3a receptor plays a novel regulatory role in the development of Th2 responses in a mouse model of pulmonary allergy. PMID: 12421977
  27. The C3a-C3aR axis may prevent an uncontrolled release of hematopoietic stem cells into peripheral blood from bone marrow PMID: 14604969
  28. C3a receptor mRNA is expressed in murine cortical and glomerular epithelium and renal medulla. PMID: 15356170
  29. Deletion of the C3a receptor is protective in myelin oligodendrocyte glycoprotein-induced experimental autoimmune encephalomyelitis in C57BL/6 mice. PMID: 15383607
  30. Data demonstrate that independently of antibody production, absence of complement C3a anaphylatoxin receptor causes enhanced killing of Pseudomonas aeruginosa despite a diminished inflammatory response in a mouse model of pneumonia. PMID: 16461429
  31. These results indicate that C5 plays a crucial role in modulating the enhanced-respiratory syncytial virus disease phenotype, by affecting expression of C3aR in the lungs. PMID: 17079327
  32. engagement of C3aR on the surface of dendritic cells leads to alterations in the level of intracellular cAMP. C3aR activation-induced depression of cAMP was associated with enhanced capacity of DCs for antigen uptake and T-cell stimulation PMID: 18812470
  33. Activation of the C3aR plays a protective, not pathologic, role in the early phase of inflammatory nephritis in the MRL/lpr model of systemic lupus erythematosus. PMID: 19167760
  34. C3aR in macrophages, and potentially adipocytes, plays an important role in adipose tissue homeostasis and insulin resistance PMID: 19581423

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Detected in varying levels in all tissues examined except the spleen. Especially abundant in heart and lung.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1