Recombinant Mouse Chemokine-binding protein 2 (Ccbp2)

Code CSB-CF004618MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Ackr2
Uniprot No.
Alternative Names
Ackr2; Ccbp2; D6; Atypical chemokine receptor 2; C-C chemokine receptor D6; Chemokine-binding protein 2; Chemokine-binding protein D6
Species
Mus musculus (Mouse)
Expression Region
1-378
Target Protein Sequence
MPTVASPLPLTTVGSENSSSIYDYDYLDDMTILVCRKDEVLSFGRVFLPVVYSLIFVLGL AGNLLLLVVLLHSAPRRRTMELYLLNLAVSNLLFVVTMPFWAISVAWHWVFGSFLCKVIS TLYSINFYCGIFFITCMSLDKYLEIVHAQPLHRPKAQFRNLLLIVMVWITSLAISVPEMV FVQIHQTLDGVWHCYADFGGHATIWKLYLRFQLNLLGFLLPLLAMIFFYSRIGCVLVRLR PPGQGRALRMAAALVIVFFMLWFPYNLTLFLHSLLDLHVFGNCEISHRLDYTLQVTESLA FSHCCFTPVLYAFCSHRFRRYLKAFLSVMLRWHQAPGTPSSNHSESSRVTAQEDVVSMND LGERQSEDSLNKGEMGNT
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades, resulting instead in chemokine sequestration, degradation, or transcytosis. Also known as interceptor (internalizing receptor) or chemokine-scavenging receptor or chemokine decoy receptor. Acts as a receptor for chemokines including CCL2, CCL3, CCL3L1, CCL4, CCL5, CCL7, CCL8, CCL11, CCL13, CCL17, CCL22, CCL23, CCL24, SCYA2/MCP-1, SCY3/MIP-1-alpha, SCYA5/RANTES and SCYA7/MCP-3. Upon active ligand stimulation, activates a beta-arrestin 1 (ARRB1)-dependent, G protein-independent signaling pathway that results in the phosphorylation of the actin-binding protein cofilin (CFL1) through a RAC1-PAK1-LIMK1 signaling pathway. Activation of this pathway results in up-regulation of ACKR2 from endosomal compartment to cell membrane, increasing its efficiency in chemokine uptake and degradation. By scavenging chemokines in tissues, on the surfaces of lymphatic vessels, and in placenta, plays an essential role in the resolution (termination) of the inflammatory response and in the regulation of adaptive immune responses. Plays a major role in the immune silencing of macrophages during the resolution of inflammation. Acts as a regulator of inflammatory leukocyte interactions with lymphatic endothelial cells (LECs) and is required for immature/mature dendritic cells discrimination by LECs.
Gene References into Functions
  1. ACKR2 (Ccbp2) is a key regulator of myeloid differentiation and function and its targeting unleashes the anti-metastatic activity of neutrophils. PMID: 29445158
  2. ACKR2 is induced after traumatic brain injuries and has a significant impact on mortality and lesion development acutely following closed head injury. PMID: 29176798
  3. ACKR2 is an important regulator of branching morphogenesis in diverse biological context; this provide the first evidence of a role for chemokines and their receptors in postnatal development processes. PMID: 27888192
  4. Ackr2 expression levels limits development of cutaneous inflammatory responses in psoriasis. PMID: 27568525
  5. ACKR2 deletion reduced renal inflammation in diabetes and the ultimate response was a high degree of protection from diabetic nephropathy. PMID: 26798651
  6. Ackr2 deficiency does not suppress autoreactive T-cell priming and autoimmune pathology, but can enhance T-cell polarization toward Th17 cells. PMID: 25348934
  7. ACKR2 can regulate fetal growth, placental structure, and neonatal mortality in mice. PMID: 25297873
  8. Further examination revealed that proximity of pro-lymphangiogenic macrophages to developing lymphatic vessel surfaces is increased in ACKR2-deficient mice and reduced in CCR2-deficient mice. PMID: 25271254
  9. some cells, including plasmacytoid dendritic cells, can express both CCR2 and ACKR2; that Ly6C(high) monocytes have particularly strong CCL2-scavenging potential in vitro and in vivo; and that CCR2 is a much more effective CCL2 scavenger than ACKR2. PMID: 24890717
  10. Expression of the D6 receptor mediates dendritic cell function and promotes corneal allograft rejection. PMID: 24357920
  11. Our data therefore indicate that D6 is able to play a cell-autonomous role as a migratory rheostat restricting migration of D6-expressing cells such as neutrophils PMID: 23670187
  12. These data demonstrate a novel role for D6 as a regulator of the transition from uninvolved to lesional skin in psoriasis. PMID: 22867710
  13. results indicate a novel mode of action for D6 during the resolution of inflammation that is instrumental to the shaping of resolving macrophage phenotypes and the completion of resolution PMID: 22651933
  14. Chemokine decoy receptor D6 limits CC-chemokine-dependent pathogenic inflammation and is required for adequate cardiac remodeling after myocardial infarction. PMID: 22796582
  15. control of CCR2 ligands by D6 regulates the traffic of Ly6C(high) monocytes and controls their immunosuppressive potential. PMID: 22504926
  16. D6, by suppressing inflammatory chemokine binding to lymphatic surfaces, and thereby preventing inflammatory leukocyte adherence, is a regulator of lymphatic function and a contributor to the integration of innate and adaptive immune responses. PMID: 21979941
  17. identify novel D6(active) B1-cell subsets, including those we term B1d, which lack CD5 and CD11b but exhibit typical B1-cell properties, including spontaneous ex vivo production of IgM, IL-10, and anti-phosphorylcholine antibody PMID: 21450903
  18. Fetal D6 suppresses inflammation in many mouse tissues, and notably, D6-deficient fetuses in D6-deficient female mice show increased susceptibility to inflammation-driven resorption. PMID: 20147628
  19. the chemokine scavenger receptor D6 has a non-redundant role in acute toxic liver injury in vivo; results support the importance of post-translational chemokine regulation and describe a new mechanism of immune modulation within the liver PMID: 19642876
  20. CCR10 engagement by locally produced CCL27 allows melanoma cells to escape host immune antitumor killing mechanisms (possibly through activation of PI3K/Akt), thereby providing a means for tumor progression PMID: 14581607
  21. CCR9-deficient IgA+ plasma cells show reduced migration into the small intestine compared with wild-type controls. PMID: 14744993
  22. The chemokine receptor D6 limits the inflammatory response in vivo. PMID: 15750596
  23. The priming of encephalitogenic T cells is impaired in D6-deficient mice, supporting a role for D6 in aspects of immunity despite its nonsignaling capacity. PMID: 16785491
  24. We also propose that lymphatic endothelial cell-expressed D6 might have a distinct but complementary role in restricting inflammatory leukocyte access to the lymphatic vasculature. PMID: 16814608
  25. The ability of D6 to scavenge chemokines in the lung is dependent on chemokine concentration. The absence of D6 increases inflammation, but reduces airway reactivity. PMID: 17095748
  26. decoy receptor for inflammatory CC chemokines D6 plays a nonredundant role in the protection against fetal loss caused by systemic inflammation and antiphospholipid antibodies PMID: 17283337
  27. demonstrate the importance of proinflammatory CC chemokines in de novo tumorigenesis and reveal chemokine sequestration by D6 to be a novel and effective method of tumor suppression PMID: 17607362
  28. the D6 decoy receptor plays a key role in setting the balance between antimicrobial resistance, immune activation, and inflammation in M. tuberculosis infection PMID: 18695004
  29. D6 expression is GATA1 dependent PMID: 18714007
  30. D6 can contribute to the development of colitis by regulating IL-17A secretion by gammadelta T cells in the inflamed colon PMID: 19342683
  31. The results indicate the induction of inflammatory chemokines after TB challenge include that D6 clearance of CC chemokines to contain the immune response and prevent excessive tissue damage. PMID: 19446728

Show More

Hide All

Subcellular Location
Early endosome. Recycling endosome. Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family, Atypical chemokine receptor subfamily
Tissue Specificity
Expressed on apoptotic neutrophils (at protein level).
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1