Recombinant Mouse Corticotropin-releasing factor receptor 1 (Crhr1)

Code CSB-CF005965MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Crhr1; Crhr; Corticotropin-releasing factor receptor 1; CRF-R-1; CRF-R1; CRFR-1; Corticotropin-releasing hormone receptor 1; CRH-R-1; CRH-R1
Species
Mus musculus (Mouse)
Expression Region
24-415
Target Protein Sequence
SLQDQQCESLSLASNVSGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNG YRECLANGSWAARVNYSECQEILNEEKKSKVHYHIAVIINYLGHCISLVALLVAFVLFLR LRSIRCLRNIIHWNLISAFILRNATWFVVQLTVSPEVHQSNVAWCRLVTAAYNYFHVTNF FWMFGEGCYLHTAIVLTYSTDRLRKWMFVCIGWGVPFPIIVAWAIGKLYYDNEKCWFGKR PGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLL GITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWRRWQD KHSIRARVARAMSIPTSPTRVSFHSIKQSTAV
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
G-protein coupled receptor for CRH (corticotropin-releasing factor) and UCN (urocortin). Has high affinity for CRH and UCN. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and down-stream effectors, such as adenylate cyclase. Promotes the activation of adenylate cyclase, leading to increased intracellular cAMP levels. Inhibits the activity of the calcium channel CACNA1H. Required for normal embryonic development of the adrenal gland and for normal hormonal responses to stress. Plays a role in the response to anxiogenic stimuli.
Gene References into Functions
  1. Expression of Crhr1 is decreased in the pituitary gland of corticotropin-releasing hormone knock-out mice exposed to repeat stress. PMID: 28993972
  2. CRF-R1 expression levels were proportional to the severity of DSS-induced colitis. Activation of CRF-R1 aggravated inflammation, and inhibition of CRF-R1 ameliorates inflammation evaluated by the DAI and histological scores in the colon samples of the DSS-treated mice. PMID: 29115460
  3. report a sexually dimorphic expression of CRFR1 within the rostral portion of the anteroventral periventricular nucleus of the hypothalamus PMID: 28823817
  4. These results revealed a prominent role for CRF1 signaling in mast cells as a positive modulator of stimuli-induced degranulation. PMID: 28684600
  5. switch in G protein coupling for type 1 corticotropin-releasing factor receptors promotes excitability in epileptic brains PMID: 27303056
  6. Study characterized the influences of early-life stress on the developmental trajectory of hippocampal pyramidal neurons, and highlighted the critical role of CRHR1 in modulating these negative outcomes evoked by early-life stress. PMID: 26792004
  7. the beneficial effects of CRFR1 antagonism seen in transgenic mice may be mechanistically linked to the modulation of oxidative stress pathways PMID: 28750017
  8. found that corticotropin-releasing factor type 1 receptor within the paraventricular nucleus of the hypothalamus is an important central component of hypothalamic-pituitary-adrenal axis regulation that prepares the organism for successive exposure to stressful stimuli. PMID: 28135239
  9. Study demonstrated that CRF1 receptor-deficiency prolongs whereas CRF2 receptor-deficiency shortens the duration of recognition memory deficits induced by morphine discontinuation, unraveling opposite roles for the two known CRF receptor subtypes in cognitive dysfunction associated with opiate withdrawal. PMID: 26907806
  10. CRFR1, in a subset of AgRP neurons, plays a regulatory role that enables appropriate sympathetic nervous system activation and consequently protects the organism from hypothermia and hypoglycemia. PMID: 27211900
  11. the cyclic AMP (cAMP) response of CRHR1 in physiologically relevant scenarios engages separate cAMP sources, involving the atypical soluble adenylyl cyclase (sAC) in addition to transmembrane adenylyl cyclases (tmACs). PMID: 27402953
  12. A role was found for extra-hypothalamic CRF-R1 in stress-escalated alcohol drinking. PMID: 26576941
  13. This study demonstrated that an anatomical mechanism for sex-differences in the convergent modulation of ventrolateral medulla catecholaminergic neurons by CRF and glutamate. PMID: 26306872
  14. these results indicate that NPS-NPSR system may regulate locomotion together with the CRF1 system in SN. PMID: 26239581
  15. bladder smooth muscle contractility is unchanged by CsA; however, there are changes in the levels of the downstream transcription factors MEF-2 and NFAT. PMID: 26052002
  16. The genetic disruption of the CRF1R pathway decreased the period of extinction in males and females suggesting that CRF/CRF1R is implicated in the duration of aversive memory. PMID: 25830629
  17. Anatomical and biochemical findings demonstrate that accumulation of Abeta is significantly reduced in the brain of Alzheimer's disease model mice lacking CRFR1 providing support for a direct relationship between CRFR1 and Abeta production pathways PMID: 25697705
  18. Results reveal the influences of early postnatal stress on the development of medial prefrontal cortex (mPFC) pyramidal neurons, and highlights CRF1 as a key molecule in modulating the detrimental stress effects on the structural organizations of mPFC PMID: 25403725
  19. This study aims to investigate the cellular localization of CRF and UCNs in the ileum and to explore whether and how this cellular expression is altered in conditions of intestinal Schistosoma mansoni-induced inflammation. PMID: 25358399
  20. NPY and PYY are required for CRF1 modulation of feeding behavior during stress. PMID: 25238483
  21. The data supports a critical involvement of Crhr1 in environmentally-induced anxiolysis. PMID: 24840018
  22. Sympathetic activity induced by naloxone-precipitated morphine withdrawal is blocked in genetically engineered mice lacking functional CRF1 receptor PMID: 25582704
  23. Crhr1 in the basolateral amygdala is critically involved as plasticity gene in the bidirectional epigenetic rescue of extremes in trait anxiety. PMID: 24518397
  24. CRHR1 has a proinflammatory and therefore a protumorigenesis effect in terms of colitis associated cancer, which may be helpful to develop new therapeutic approaches for inflammation and cancer prevention and treatment PMID: 25015995
  25. cPLA2 participates in CRHR1-induced apoptosis and CRHR2-inhibited apoptosis. PMID: 24776847
  26. CRFR1 signaling in the ventral tegmental area presents a target for convergent effects of both cue- and stress-induced cocaine-seeking pathways PMID: 25164654
  27. data suggest that the gene x stress exposure interaction is based on naturally occurring genetic variations in the Crhr1 gene associated with enhanced CRHR1-mediated signaling. PMID: 24773341
  28. Leptin regulates corticotropin-releasing factor and urocortin 2/3 mRNA in hypothalamic neurons. PMID: 24083959
  29. Altered CRF1 receptor-mediated signaling in the ventral tegmental area promotes binge-like alcohol consumption in mice. PMID: 23763790
  30. Blockade of CRF1 receptors does not exert specific effects on ethanol intake in an animal model of binge drinking. PMID: 23398267
  31. CRFR1 plays important roles in whole body energy homeostasis PMID: 24054833
  32. This study demonistrated that Expression of CRFR1 and Glu5R mRNA in different brain areas following repeated testing in mice that differ in habituation behaviour. PMID: 23458743
  33. ERK1/2 activation in response to CRH is biphasic, involving a first cAMP- and B-Raf-dependent early phase and a second phase that critically depends on CRHR1 internalization and beta-arrestin2. PMID: 23371389
  34. studies show that SAP97 interactions with CRFR1 attenuate CRFR1 endocytosis and that SAP97 is involved in coupling G protein-coupled receptors to the activation of the ERK1/2 signaling pathway. PMID: 23576434
  35. the CRH-CRHR1 system interacts with the nectin-afadin complex to mediate the effects of stress on memory and structural plasticity. PMID: 23644483
  36. CRHR1 agonism stimulates rat and mouse fetal testis steroidogenesis PMID: 23133512
  37. Reductions in anxiety and corticosteroid levels conferred by heterozygosity of CRF receptor type-1 do not improve a deficit in working memory observed in APP/hAbeta/PS1 mice. PMID: 22336193
  38. The corticotropin-releasing hormone (CRH) and its type 1 receptor (CRHR1) play a central role in coordinating the endocrine, autonomic, and behavioral responses to stress. PMID: 22886732
  39. The findings highlight the importance of forebrain CRHR1 in modulating some of the anxiogenic effects of early-life stress. PMID: 22672268
  40. CRHR1 does not have a role in basal alcohol intake or relapse-like drinking situations with a low stress load. PMID: 22113086
  41. Data show that CRFR1 and CRFR2 double-KO mice did not exhibit repeated stress-induced alterations in tau-P or solubility. PMID: 22451915
  42. our data reveal a novel anxiolytic role for CRFR1 in the globus pallidus external. PMID: 22131403
  43. Data suggest that corticotropin-releasing factor receptor types 1 and 2 mediation of stress-induced hippocampal tau phosphorylation may be limited to emotional stressors. PMID: 21722209
  44. results suggest that forebrain CRF1 is crucial for the programming of cognitive function by early-life stress. PMID: 21940453
  45. Present results are suggestive that CRF1 (but not CRF2) receptors play a crucial role in the anxiogenic and antinociceptive effects induced by CRF in the dPAG in mice. PMID: 21723867
  46. CRH-R1 inhibition is not protective against pneumococcal disease induced by stress. PMID: 21774994
  47. results define a bidirectional model for the role of CRHR1 in anxiety and suggest that an imbalance between CRHR1-controlled anxiogenic glutamatergic and anxiolytic dopaminergic systems might lead to emotional disorders PMID: 21885734
  48. forebrain CRHR1 deficiency prevented the down-regulation of hippocampal glucocorticoid receptor expression by chronic stress but induced increased body weight gain during persistent stress exposure. PMID: 21296667
  49. Data show that stress has opposing effects on CRHR1 and CRHR2 neuronal systems, and suggest that regulation of the relative contribution of the two CRH receptors to brain CRH pathways may be essential in coordinating physiological responses to stress. PMID: 19302188
  50. This study presented a VSDI assay for the investigation of neuronal activity propagation through the HF and demonstrates that CRH, via CRHR1 PMID: 20619419

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Endosome.
Protein Families
G-protein coupled receptor 2 family
Tissue Specificity
Detected in brain cortex (at protein level).
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1