Recombinant Mouse Cysteinyl leukotriene receptor 1 (Cysltr1)

Code CSB-CF006465MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Cysltr1; Cyslt1; Cyslt1r; Cysteinyl leukotriene receptor 1; CysLTR1; Cysteinyl leukotriene D4 receptor; LTD4 receptor
Species
Mus musculus (Mouse)
Expression Region
1-352
Target Protein Sequence
MYLQGTKQTFLENMNGTENLTTSLINNTCHDTIDEFRNQVYSTMYSVISVVGFFGNSFVL YVLIKTYHEKSAFQVYMINLAIADLLCVCTLPLRVVYYVHKGKWLFGDFLCRLTTYALYV NLYCSIFFMTAMSFFRCVAIVFPVQNINLVTQKKARFVCIGIWIFVILTSSPFLMYKSYQ DEKNNTKCFEPPQNNQAKKYVLILHYVSLFFGFIIPFVTIIVCYTMIILTLLKNTMKKNM PSRRKAIGMIIVVTAAFLVSFMPYHIQRTIHLHLLHSETRPCDSVLRMQKSVVITLSLAA SNCCFDPLLYFFSGGNFRRRLSTFRKHSLSSMTYVPKKKASLPEKGEEICNE
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for cysteinyl leukotrienes mediating constriction of the microvascular smooth muscle during an inflammatory response. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. The rank order of affinities for the leukotrienes is LTD4 >> LTE4 = LTC4 >> LTB4.
Gene References into Functions
  1. Montelukast also served a protective role in a murine ovariectomy (OVX) and unloadinginduced bone loss model. Altogether, these results confirmed that the CysLTR1 antagonist exerted an inhibitory effect on OC formation in vitro and in vivo. It may be useful for the treatment of bone diseases associated with excessive bone resorption. PMID: 29916540
  2. The study presents a genetic approach in a colitis-associated colon cancer model further supporting an important role for CysLT1R signaling in colon tumorigenesis, driving immune mediators to promote immune cell infiltration in tumors. PMID: 28410235
  3. Mechanistically, the effect of montelukast on osteoblastic differentiation acted by activating the extracellular regulated protein kinases (ERK) pathway. The obtained results suggested that montelukast promotes proliferation and differentiation in osteoblasts exposed to overload mechanics. PMID: 29032198
  4. this study shows that CysLT1R-deficient mice that were exposed to chlorine demonstrated airway hyperresponsiveness to inhaled methacholine significantly greater than in wild-type BALB/c mice PMID: 27226094
  5. The important role that CysLTR1 plays in colorectal cancer and intestinal polyps development. PMID: 26979937
  6. Leukotriene D4 and prostaglandin E2 signals synergize and potentiate vascular inflammation in a mast cell-dependent manner through cysteinyl leukotriene receptor 1 and E-prostanoid receptor 3 PMID: 26255103
  7. Involvement of CysLT1R in a model of asthma. PMID: 25477712
  8. Suggest that myogenic tone is determined by AT1 and CysLT1 receptors acting together as mechanosensors via Gq/11-protein activation. PMID: 25395620
  9. It plays a critical role in Ab1e42-induced neurotoxicity. PMID: 24269024
  10. The CysLT(1) and CysLT(2) receptors were primarily localized in neurons, microglia and neutrophils PMID: 23132680
  11. CysLT1R mediates LTD4-induced activation of microglial cells. PMID: 24141567
  12. In an animal model of cognition impairment, CysLT1 receptor signaling is identified as proinflammatory and proamyloidogenic. PMID: 22982445
  13. a single mutation of Thr151Gly in the 2nd inner loop of sysLT1 had a slight inhibitory effect on the desensitization. PMID: 23485744
  14. present novel data that CysLT1R is expressed on ILC2s and LTD potently induces CysLT1R-dependent ILC2 production of IL-4, IL-5, and IL-13 PMID: 23688412
  15. CysLT1R, CysLT2R and GPR17 might be involved in the MPTP-induced Parkinson disease damage in mice. PMID: 23505108
  16. leukotriene D(4) recepter may be involved in the development of seizures in mice. PMID: 21641195
  17. Rotenone induced an increased expression of CysLT(1) receptor in BV2 microglial cells. PMID: 21488207
  18. Cysltr1-deficient C57BL/6 mice are protected from pulmonary inflammation both in active house dust mite sensitization and challenge, revealing a broad and dose-related role for CysLT1R in antigen presentation and downstream responses. PMID: 20574000
  19. These findings provide evidence for a role for CysLTRs in bone marrow cells in transducing cytokine regulatory signals. PMID: 20219953
  20. determination of role in enhanced vascular permeability of mice undergoing acute inflammatory responses PMID: 11932261
  21. Targeted disruption of the CysLT(1) receptor significantly increases both the concentration of cys-LTs in the bronchoalveolar lavage fluid and the magnitude of septal thickening in the lung. PMID: 14970333
  22. The type 1 cysteinyl leukotriene receptor (CysLT1) is involved in the recruitment of activated alpha beta and gamma delta T cells to inflamed tissues. PMID: 16002666
  23. findings show that CysLT1 receptor attenuates while CysLT2 receptor facilitates oxygen glucose deprivation -induced PC12 cell death PMID: 16756959
  24. Data show that cysteinyl leukotriene receptor 1 modulates cryoinjury in mice at least partly, and postinjury treatment with its antagonist pranlukast exerts the protective effect with a therapeutic window of 30 min. PMID: 17588329
  25. CysLT2 receptors interact with CysLT1 receptors and down-modulate cysteinyl leukotriene dependent mitogenic responses of mast cells. PMID: 17693579
  26. cysteinyl leukotriene type 1 receptor acts as a negative regulator of chondrocyte proliferation, with important and previously unrecognized implications for both fracture repair, and in a broader context, systemic chondrocyte growth and differentiation PMID: 19544365

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Widely expressed, with higher expression in the lung and skin, intermediate levels in the heart, kidney and stomach and lower levels in several other tissues. Isoform 1 is the most abundant form in all tested tissues.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1