Recombinant Mouse Cytochrome c oxidase assembly protein COX15 homolog(Cox15)

Code CSB-CF804356MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8BJ03
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MQRLLLPSLRALTGSRNVGLLVPRVASRTQCGSSCGSQRPLRPGQYSTITEVALQSGKGT VSLPSRAAERAVGRWLLVCSGTVAGAVILGGVTRLTESGLSMVDWHLIKEMKPPTSQEEW EAEFQKYQQFPEFKILNHDMTLAEFKFIWYMEYSHRMWGRAVGLAYILPAAYFWRKGWLN RGMKGRVLALCGLVCFQGLLGWYMVKSGLEEKPESYDIPRVSQYRLAAHLGSALVLYCAS LWTSLSLLLPQHKLPETRQLLWLRRFAGGTAGLVFLTALSGAFVAGLDAGLVYNSFPKMG ESWIPEDLLTFSPVLKNVFENPTMVQFDHRLLGVTSVTAITVLYFLSRRIPLPRRTKMAA VTLLALAYAQVALGISTLLMYVPTPLAATHQSGSLALLSGALWLMNELRRVPK
Source in vitro E.coli expression system
Gene Names Cox15
Protein Names Recommended name: Cytochrome c oxidase assembly protein COX15 homolog
Expression Region 1-413
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May be involved in the biosynthesis of heme A.
Subcellular Location Mitochondrion membrane, Multi-pass membrane protein
Protein Families COX15/CtaA family
Database Links

KEGG: mmu:226139

STRING: 10090.ENSMUSP00000041820

UniGene: Mm.248237

Pathway Oxidative Phosphorylation

Related Products

Cox15 Proteins

Cox15 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.