Code | CSB-CF889540MO |
MSDS | |
Size | Pls inquire |
Source | in vitro E.coli expression system |
Have Questions? | Leave a Message or Start an on-line Chat |
There are currently no reviews for this product.
1. Could we tag the recombinant protein with Biotin? 2. Ackr1 is a transmembrane protein, did Cusabio have any test to verify the structure of the protein post translation?
We can try the following 2 proteins:
Recombinant Mouse Duffy antigen/chemokine receptor (Darc), Biotin conjugated
CSB-CF889540MO-A >> in vitro E.coli expression system
Expression Region: 1-334 aa (Full Length)
Tag information: Tag type will be determined during the manufacturing process.
Target Protein Sequence:
MGNCLYPVETLSLDKNGTQFTFDSWNYSFEDNYSYELSSDYSLTPAAPCYSCNLLDRSSLPFFMLTSVLGMLASGSILFAILRPFFHWQICPSWPILAELAVGSALFSIAVPILAPGLHSAHSTALCNLGYWVWYTSAFAQALLIGCYACLNPRLNIGQLRGFTLGLSVGLWGAAALSGLPVALASDVYNGFCTFPSSRDMEALKYTHYAICFTIFTVLPLTLLAAKGLKIALSKGPGPWVSVLWIWFIFWWPHGMVLIFDALVRSKTVLLYTCQSQKILDAMLNVTEALSMLHCVATPLLLALFCHQTTRRSLSSLSLPTRQASQMDALAGKS
Uniprot Link: https://www.uniprot.org/uniprotkb/Q9QUI6
MP-VLPS can be used as N-terminal Avi-tag as an vitro biomotinization:
Recombinant Mouse Duffy antigen/chemokine receptor (Darc)-VLPs, Biotinylated
CSB-MP889540MO-B >> Mammalian cell
Expression Region: 1-334 aa (Full Length)
Tag information:Tag type will be determined during the manufacturing process.
Target Protein Sequence:
MGNCLYPVETLSLDKNGTQFTFDSWNYSFEDNYSYELSSDYSLTPAAPCYSCNLLDRSSLPFFMLTSVLGMLASGSILFAILRPFFHWQICPSWPILAELAVGSALFSIAVPILAPGLHSAHSTALCNLGYWVWYTSAFAQALLIGCYACLNPRLNIGQLRGFTLGLSVGLWGAAALSGLPVALASDVYNGFCTFPSSRDMEALKYTHYAICFTIFTVLPLTLLAAKGLKIALSKGPGPWVSVLWIWFIFWWPHGMVLIFDALVRSKTVLLYTCQSQKILDAMLNVTEALSMLHCVATPLLLALFCHQTTRRSLSSLSLPTRQASQMDALAGKS
Uniprot Link: https://www.uniprot.org/uniprotkb/Q9QUI6
Please note: As for VLP proteins:
According to our current experience, VLP proteins are not suitable for ligand interaction because there are other unrelated host membrane proteins on the VLP envelope, which would cause strong background interference when interacting with ligands.
If it is used for SPR/BLI and other applications, there are certain requirements for the chip and experimental protocol.
① The VLP protein has an envelope and requires a chip that can bind vesicles (for example: Vesicle Capture (VesCap) chip), conventional CM5, NTA , SA chip is not suitable,
② or use a double-antibody cross-concentration strategy, which requires antibodies that recognize two different epitopes of the VLP antigen.
One of the antibodies is first coated on the chip (such as CM5 chip), and then combined with the VLP antigen and then tested with the other antibody. Affinity.
Of course, affinity determination solutions that do not require a chip can also be used, such as: MST
Transmembrane protein, this is futures protein. We did not verify transmembrane conditions. The expression of VLPS protein is the self -assembled nanoprocinone of the virus shell protein. The method of germination is released. During the release process, it will be integrated with the cell membrane (target protein on the cell membrane), and the release of nano particles (that is, VLPS particles) will display transmembrane proteins. Natural conformity.