Recombinant Mouse Duffy antigen/chemokine receptor (Darc)

Code CSB-CF889540MO
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Ackr1
Uniprot No.
Alternative Names
Ackr1; Darc; Dfy; Fy; Atypical chemokine receptor 1; Duffy antigen/chemokine receptor; CD antigen CD234
Species
Mus musculus (Mouse)
Expression Region
1-334
Target Protein Sequence
MGNCLYPVETLSLDKNGTQFTFDSWNYSFEDNYSYELSSDYSLTPAAPCYSCNLLDRSSL PFFMLTSVLGMLASGSILFAILRPFFHWQICPSWPILAELAVGSALFSIAVPILAPGLHS AHSTALCNLGYWVWYTSAFAQALLIGCYACLNPRLNIGQLRGFTLGLSVGLWGAAALSGL PVALASDVYNGFCTFPSSRDMEALKYTHYAICFTIFTVLPLTLLAAKGLKIALSKGPGPW VSVLWIWFIFWWPHGMVLIFDALVRSKTVLLYTCQSQKILDAMLNVTEALSMLHCVATPL LLALFCHQTTRRSLSSLSLPTRQASQMDALAGKS
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades, resulting instead in chemokine sequestration, degradation, or transcytosis. Also known as interceptor (internalizing receptor) or chemokine-scavenging receptor or chemokine decoy receptor. Has a promiscuous chemokine-binding profile, interacting with inflammatory chemokines of both the CXC and the CC subfamilies but not with homeostatic chemokines. Acts as a receptor for chemokines including CCL2, CCL5, CCL7, CCL11, CCL13, CCL14, CCL17, CXCL5, CXCL6, IL8/CXCL8, CXCL11, GRO, RANTES, MCP-1 and TARC. May regulate chemokine bioavailability and, consequently, leukocyte recruitment through two distinct mechanisms: when expressed in endothelial cells, it sustains the abluminal to luminal transcytosis of tissue-derived chemokines and their subsequent presentation to circulating leukocytes; when expressed in erythrocytes, serves as blood reservoir of cognate chemokines but also as a chemokine sink, buffering potential surges in plasma chemokine levels.
Gene References into Functions
  1. Our findings in mice suggest that DARC alters the severity and resolution of AHR. These findings are complimented by our human analyses in which select DARC SNPs are associated with worse asthma control and symptoms. PMID: 28471517
  2. DARC was exquisitely restricted to post-capillary and small collecting venules and completely absent from arteries, arterioles, capillaries, veins, and most lymphatics in every tissue analyzed. Intravital microscopy showed that adhesive leukocyte-endothelial interactions were restricted to DARC(+) venules. DARC was detectable over the entire circumference of V-ECs, but was more concentrated at cell-cell junctions. PMID: 28526034
  3. DARC regulates recruitment of osteoclast precursors at the inflammation site PMID: 27376530
  4. Nucleated erythroid cells had high expression of ACKR1, which facilitated their direct contact with hematopoietic stem cells. The absence of erythroid ACKR1 altered mouse hematopoiesis including stem and progenitor cells, which ultimately gave rise to phenotypically distinct neutrophils that readily left the circulation, causing neutropenia. PMID: 28553950
  5. The DARC/CD234 is expressed on macrophages and stabilizes CD82 on long-term repopulating hematopoietic stem cells, promoting their quiescence. PMID: 26996598
  6. Ackr1 deficiency appears to be protective in the ApoE knockout model of atherogenesis, but it is associated with only modest changes in cytokine and chemokine expression as well as T-cell subset frequency and inflammatory macrophage content. PMID: 25858253
  7. the results suggest that normal motor function and behavior may partly depend on negative regulation of Purkinje cell activity by Ackr1. PMID: 24997773
  8. Darc plays a role in modulating the regulation of inflammatory response to bone injury and that lack of Darc expression promotes cartilage formation in fracture calluses but does not affect bony union or fracture healing at 21 days post-fracture. PMID: 24146983
  9. The data showed a role for erythrocyte DARC as a chemokine reservoir and that endothelial DARC contributes to the pathogenesis of experimental autoimmune encephalomyelitis by shuttling chemokines across the blood-brain barrier. PMID: 24625696
  10. DARC is crucial for chemokine-mediated leukocyte recruitment in vivo. PMID: 20061440
  11. Plasmodium yoelii uses the murine Duffy antigen receptor for chemokines as a receptor for normocyte invasion and an alternative receptor for reticulocyte invasion. PMID: 11929753
  12. Vascular endothelial cells may induce Duffy protein to regulate leukocytes and/or chemokine trafficking PMID: 12697152
  13. role of the Duffy antigen and glycophorin A as receptors for rodent malaria parasite invasion of erythrocytes PMID: 15278442
  14. we have defined the binding domain on the mDuffy protein for Plasmodium yoelii binding to erythrocytes PMID: 16386320
  15. DARC functions to clear angiogenic CXC chemokines from the prostate tumor microcirculation PMID: 16394268
  16. Darc regulates bone mineral density (BMD)negatively by increasing osteoclast formation. Darc is proposed as a candidate gene for chromosome 1 BMD QTL2. PMID: 17416748
  17. Results indicate that endothelial cell overexpression of mDARC increased leukocyte trafficking to the tumor, reduced the growth of blood vessels into the tumor, and reduced the growth rate of melanoma. PMID: 17942909
  18. Loss of red cell chemokine scavenging promotes transfusion-related lung inflammation PMID: 19064726
  19. renal inflammation developed more rapidly in DARC-deficient mice, without affecting the extent of renal injury at later time points PMID: 19498001
  20. DARC regulates lung inflammation by controlling the distribution and presentation of chemokines that bind CXCR2. PMID: 19499525

Show More

Hide All

Subcellular Location
Early endosome. Recycling endosome. Membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family, Atypical chemokine receptor subfamily
Tissue Specificity
Expressed in liver and brain.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X