Recombinant Mouse ER lumen protein retaining receptor 3(Kdelr3)

Code CSB-CF848101MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8R1L4
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MNVFRILGDLSHLLAMILLLVKIWRSKSCAGISGKSQILFALVFTTRYLDLFSNFISIYN TVMKVVFLLCAYVTVYMIYWKFRKTFDIENDTFRLEFLLVPVTGLSFLVNYSYTPMEVLW TFSIYLESVAILPQLFMISKTGEAETITTHYLFFLGLYRLLYLANWIRRYQTENFYDQIS VVSGVVQTIFYCDFFYLYVTKVLKGKKLSLPVPV
Source in vitro E.coli expression system
Gene Names Kdelr3
Protein Names Recommended name: ER lumen protein retaining receptor 3 Alternative name(s): KDEL endoplasmic reticulum protein retention receptor 3 Short name= KDEL receptor 3
Expression Region 1-214
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required for the retention of luminal endoplasmic reticulum proteins. Determines the specificity of the luminal ER protein retention system. Also required for normal vesicular traffic through the Golgi. This receptor recognizes K-D-E-L (By similarity).
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families ERD2 family
Database Links

KEGG: mmu:105785

STRING: 10090.ENSMUSP00000010974

UniGene: Mm.298199

Related Products

Kdelr3 Proteins

Kdelr3 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.