Recombinant Mouse Estradiol 17-beta-dehydrogenase 2(Hsd17b2)

Code CSB-CF010772MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P51658
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MSPFASESAWLCLAAAAVLGGTLLCGCRSGRQLRSQAVCLAGLWGGACLLSLSLLCTLFLLSVACFLLLYMSSSDQDLLPVDQKAVLVTGADSGFGHGLAKHLDKLGFTVFAGVLDKEGPGAEELRKHCSERLSVLQMDVTKPEQIKDAHSKVTEKIQDKGLWAVVNNAGVFHLPIDGELIPMSIYRKCMAVNFFGTVEVTKAFLPLLRKSKGRLVNVSSMGGTVPLQMTSAYAATKAALTMFSTIIRQELDKWGVKVVTIKPGGFKTNITGSQDIWDKMEKEILDHFSKDIQENYGQDYVHTQKLIIPTLKERSNPDITPVLRDIQHAISARNPSSFYYPGRMAYLWVCLAAYCPTSLLDYVIKKGFYPQPTPRALRTVH
Source in vitro E.coli expression system
Gene Names Hsd17b2
Protein Names Recommended name: Estradiol 17-beta-dehydrogenase 2 EC= 1.1.1.62 Alternative name(s): 17-beta-hydroxysteroid dehydrogenase type 2 Short name= 17-beta-HSD 2 Testosterone 17-beta-dehydrogenase EC= 1.1.1.63
Expression Region 1-381
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Capable of catalyzing the interconversion of testosterone and androstenedione, as well as estradiol and estrone. Also has 20-alpha-HSD activity. Uses NADH while EDH17B3 uses NADPH (By similarity).
Subcellular Location Membrane, Single-pass type II membrane protein
Protein Families Short-chain dehydrogenases/reductases (SDR) family
Database Links

KEGG: mmu:15486

STRING: 10090.ENSMUSP00000034304

UniGene: Mm.276466

Related Products

Hsd17b2 Proteins

Hsd17b2 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.