Alternative Names
Cmtr2; Ftsjd1; Cap-specific mRNA; nucleoside-2'-O--methyltransferase 2; Cap methyltransferase 2; Cap2 2'O-ribose methyltransferase 2; MTr2; FtsJ methyltransferase domain-containing protein 1
Species
Mus musculus (Mouse)
Target Protein Sequence
MSKRRKLPARQPACLETFSPDVLNDVSELFAKSFSYRKPLDNEWQLPAPTESFSCGHLEF
RALLDLKNSLNEVKNLLSDKKLDEWHRHTAFTNKAGKIISHVKKAVNAELCTQAWCKFQE
ILCSFPLIPQEAFQSGRLNSLHLCEAPGAFIASLNHYLKSHRFPCEWSWVANSLNPYHEA
NDNLRMITDDRLMANTLHCWYFGPDNTGDIMTLKYLTGLQDFLSGMSPIHLVTADGSFDC
QGNPGEQEALVSSLHYCEAVTALITLGDGGSFVLKMFTLFEHCSVNLMYLLNCSFDQVHV
FKPATSKAGNSEVYVVCLRYKGREAVQPLLSRMVLNFGTEMTRKALFPHHVIPKSFLERH
EECCTFFHRYQLETISENIRLFESMGTGEQERLNNLRDCAVQYFMQKFQLKPLSRNHWLV
KKSNIGCSMNTKWFGQRNKYFKTYNERKMMETLSWKDKVAKGYFNSWAEEHTVYHPGQNS
LLEGTASSLEYQSWQVLEGKKLPKVKCSPFCDGEILKTLNEAIEKSLGEALSVDAKVSSK
QQYRCCPVFSEESVLSELLRLTKCLPDEQGAEPSGPVKCLLVGSPAVCDLQMPAPLEIQL
VESVELTAFSCSLLHDGDPAYQHLFLDCLLHSLRRLHRGDVMVLPILSCFTRFMAGLTFV
LHGCFRFITFSCPTSLEPLRTCAVLLCIGYQNLPDAVFQFLQNVHDLLSKLLHPSAPRQI
LQFLPMEALLQGTLLDFLWDLNAAIAKRHLHLIIQGERDQAIGSLEL
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If
you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the
bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We
recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at
-20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.
Description
The recombinant Mouse Cmtr2 protein is a cell-free system in vitro E.coli expressed Full Length protein. In cell-free systems, synthesis of the protein can be carried out in vitro using extracts of whole cells that are compatible with translation. These cell extracts contain all the molecules and enzymes that are needed to transcribe, translate, and post-translationally modify the recombinant protein. With additional supplements of cofactors, Cmtr2 proteins can be formed in a few hours. However, this system may not be applicable for the large-scale production of recombinant proteins. Advantages of this system include that proteins can be synthesized without cell culturing; also, it is possible to express many proteins together.
Cmtr2 is the second transcribed nucleotide ribose O-2 methyltransferase found in both the nucleus and cytoplasm of MCF7 cells. It exhibits methyltransferase activity on the second transcribed nucleotide (cap2) at the 2-prime-O-ribose position of capped mRNA and small nuclear RNA. Studies have shown that Cmtr2 can methylate substrates, regardless of the presence of methylation of the cap guanosine or N1 ribose. Mutations in Cmtr2 have been detected in patients with lung adenocarcinomas.
