Recombinant Mouse G protein-activated inward rectifier potassium channel 1 (Kcnj3)

Code CSB-CF012056MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Kcnj3; Girk1; G protein-activated inward rectifier potassium channel 1; GIRK-1; Inward rectifier K(+ channel Kir3.1; Potassium channel, inwardly rectifying subfamily J member 3
Species
Mus musculus (Mouse)
Expression Region
1-501
Target Protein Sequence
MSALRRKFGDDYQVVTTSSSGSGLQPQGPGQGPQQQLVPKKKRQRFVDKNGRCNVQHGNL GSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNY TPCVANVYNFPSAFLFFIETEATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCM FIKMSQPKKRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPE GEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQTEQFEVVVILE GIVETTGMTCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKE QEEMLLMSSPLIAPAITNSKERHNSVECLDGLDDISTKLPSKLQKITGREDFPKKLLRMS STTSEKAYSLGDLPMKLQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGG PTRMEGNLPAKLRKMNSDRFT
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This potassium channel is controlled by G proteins. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. This receptor plays a crucial role in regulating the heartbeat.
Gene References into Functions
  1. Ethanol activates GIRK1 by shifting the conformational equilibrium processes, which are responsible for the gating of GIRK, to stabilize an open conformation of the cytoplasmic ion gate. PMID: 29581303
  2. Kir 3.1 channels are important for supraspinal antinociception and presynaptic GABA release inhibition by oxycodone in the femur bone cancer model PMID: 25521524
  3. GABA neurons in the ventral tegmental area express GIRK1 (and GIRK2) subunits. PMID: 25948263
  4. K(IR)3.1 channels play a primary role in the antinociceptive effects of oxycodone, but not those of morphine, at supraspinal sites and suggest that supraspinal K(IR)3.1 channels are responsible for the unique analgesic profile of oxycodone. PMID: 24117458
  5. siRNA knock-down of NgR1 resulted in a selective increase of GABAB R1 and GABAB R2 protein and an increase in GIRK1. PMID: 23829864
  6. Discontinuous and sometime opposing elements in Girk1 underlie the Girk1-dependent potentiation of receptor-dependent and receptor-independent heteromeric channel activity. PMID: 23236146
  7. Mechanism for functional dysregulation in the dorsal raphe follows tyrosine phosphorylation of repeated stress-activated Kir3.1 channels. PMID: 22956823
  8. NMR analyses of the Gbetagamma binding and conformational rearrangements of the cytoplasmic pore of G protein-activated inwardly rectifying potassium channel 1 (GIRK1). PMID: 21075842
  9. Agonist-induced localization of Gq-coupled receptors and G protein-gated inwardly rectifying K+ (GIRK) channels to caveolae determines receptor specificity of phosphatidylinositol 4,5-bisphosphate signaling PMID: 21041306
  10. The atrial potassium channel, I(KACH), ion channel gating is accelerated in atrial myocytes through the RGS6/Gbeta5 complex. PMID: 20884879
  11. Dopamine neurons from Girk1 knock-out mice (and Girk2) exhibited elevated glutamatergic neurotransmission and increased synaptic levels of AMPA glutamate receptors. PMID: 20557431
  12. Data suggest HL-1 cells express GIRK1/4 and M2 muscarinic receptors and are a good model to study acetylcholine-activated potassium currents. PMID: 20186548
  13. confers properties to I(KACh) that enhance channel activity and that Kir3.4 homomultimers do not contribute significantly to the muscarinic-gated potassium current PMID: 12374786
  14. Kcnj3 is associated with idiopathic generalised epilepsy syndromes by genotype. PMID: 12458027
  15. A cytoplasmic pore in the GIRK1 channel extends the ion pathway to 60 A, nearly twice the length of a canonical transmembrane K(+) channel. The cytoplasmic pore is lined by acidic and hydrophobic amino acids; polyamines block this pore. PMID: 12507423
  16. We found GIRK1 and GIRK2 subunits in the spinal cord dorsal horn; GIRK1 and GIRK2 knock-out mice exhibited hyperalgesia. Furthermore GIRK1 and GIRK2 knock-out mice showed decreased analgesic responses after spinal administration of higher morphine doses PMID: 15028774
  17. Data show that the composition of the Kir3.1 and Kir 3.4 subunits of the G protein-gated potassium channel changes during embryonic development. PMID: 15467839
  18. phosphorylation of K(ir)3.1 in spinal cord is induced by acute inflammation, chronic neuropathic pain, and behavioral stress PMID: 16223722
  19. GIRK1 exhibited the most widespread and robust labeling in the cerebellum, with labeling particularly prominent in granule cells,Purkinje neurons,basket cells. PMID: 18088366
  20. GIRK channels make important contribution to a range of behaviors and may represent points of therapeutic intervention in disorders of anxiety, spasticity and reward PMID: 18194467
  21. This study investigates the action of CRF on G-protein-linked inhibitory postsynaptic currents (IPSCs) mediated by GIRK (Kir3) channels in dopamine neurons. PMID: 19279570
  22. The association of GIRK channels and GABA(B) receptors with excitatory synapses at both post- and pre-synaptic sites indicates their intimate involvement in the modulation of glutamatergic neurotransmission in the cerebellum. PMID: 19558451
  23. two spermine molecules bind to a tetramer of Kir3.1/GIRK1 with a dissociation constant of 26 microM, which is lower than other blockers. PMID: 19620244
  24. The authors present a crystal structure of the cytoplasmic portion of a Kir channel with five ions bound and demonstrate that a constriction near the intracellular end of the pore, acting as a gasket, prevents K(+) ions from bypassing the blocker. PMID: 19915587

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ3 subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1