Product Details

Target Names

Gpr143

Uniprot No.

P70259

Alternative Names

Gpr143; Oa1; G-protein coupled receptor 143; MOA1; Ocular albinism type 1 protein homolog

Species

Mus musculus (Mouse)

Expression Region

1-405

Target Protein Sequence

MASPRLGIFCCPTWDAATQLVLSFQPRVFHALCLGSGTLRLVLGLLQLLSGRRSVGHRAP ATSPAASVHILRAATACDLLGCLGIVIRSTVWIAYPEFIENISNVNATDIWPATFCVGSA MWIQLLYSACFWWLFCYAVDVYLVIRRSAGRSTILLYHIMAWGLAVLLCVEGAVMLYYPS VSRCERGLDHAIPHYVTTYLPLLLVLVANPILFHKTVTSVASLLKGRKGVYTENERLMGA VIKTRFFKIMLVLIACWLSNIINESLLFYLEMQPDIHGGSLKRIQNAARTTWFIMGILNP AQGLLLSLAFYGWTGCSLDVHPPKMVIQWETMTASAAEGTYQTPVRSCVPHQNPRKVVCV GGHTSDEVLSILSEDSDASTVEIHTATGSCNIKEVDSISQAQGEL

Protein Length

Full length protein

Tag Info

Tag type will be determined during the manufacturing process.

The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer before Lyophilization

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet

Please contact us to get it.

Target Background

Function

Receptor for tyrosine, L-DOPA and dopamine. After binding to L-DOPA, stimulates Ca(2+) influx into the cytoplasm, increases secretion of the neurotrophic factor SERPINF1 and relocalizes beta arrestin at the plasma membrane; this ligand-dependent signaling occurs through a G(q)-mediated pathway in melanocytic cells. Its activity is mediated by G proteins which activate the phosphoinositide signaling pathway. Plays also a role as an intracellular G protein-coupled receptor involved in melanosome biogenesis, organization and transport.

Gene References into Functions

OA1 expression in both neuronal and non-neuronal tissues was examined by immunohistochemical analyses, results suggested that OA1 may modulate the monoaminergic functions in both peripheral and central nervous systems PMID: 25601010
Melanosome-autonomous regulation of size and number: the OA1 receptor sustains PMEL expression. PMID: 24650003
These results identify the Oa1 transducer Galphai3 as the first downstream component in the Oa1 signaling pathway. PMID: 21931697
OA1 interacts with MART-1 at early stages of melanogenesis to control melanosome identity and composition. PMID: 19717472
Asparagine at amino acid 106 is essential for N-glycosylation of the Oa1 protein. Mutation at amino acid 106 that eliminated glycosylation did not affect the endo/lysosomal distribution of Oa1 protein in cells. PMID: 11775061
the ocular albinism type 1 gene expression is controlled by microphthalmia transcription factor (Mitf) PMID: 15254223
The findings indicate that Oa1 is involved in the regulation of melanosome maturation at two steps, Oa1 controls the abundance of melanosomes in RPE cells and has a function in the maintenance of a correct melanosomal size. PMID: 16303920
G alpha i3, like Oa1, plays important role in melanosome biogenesis. Common Oa1-G alpha i3 signaling pathway may ultimately affect axonal growth through optic chiasm. PMID: 18378571
data point to defective regulation of organelle transport in pigment cells in absence of OA1; results enlighten novel function for OA1 in pigment cells & suggest ocular albinism type 1 may result from a different mechanism than previously thought PMID: 18697795

Hide All

Subcellular Location

Melanosome membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein. Apical cell membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor OA family

Database Links

KEGG: mmu:18241

STRING: 10090.ENSMUSP00000026383

UniGene: Mm.5157

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：

Code	CSB-CF009758MO
MSDS	MSDS
Size	Pls inquire
Source	in vitro E.coli expression system
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse G-protein coupled receptor 143 (Gpr143)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage