Recombinant Mouse G-protein coupled receptor 3 (Gpr3)

Code CSB-CF009800MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Gpr3
Uniprot No.
Alternative Names
Gpr3; Gpcr3; G-protein coupled receptor 3; GPCR21
Species
Mus musculus (Mouse)
Expression Region
1-330
Target Protein Sequence
MMWGAGSSMAWFSAGSGSVNVSSVDPVEEPTGPATLLPSPRAWDVVLCISGTLVSCENAL VVAIIVGTPAFRAPMFLLVGSLAVADLLAGLGLVLHFAADFCIGSPEMSLMLVGVLAMAF TASIGSLLAITVDRYLSLYNALTYYSETTVTRTYVMLALVWVGALGLGLVPVLAWNCRDG LTTCGVVYPLSKNHLVVLAIAFFMVFGIMLQLYAQICRIVCRHAQQIALQRHLLPASHYV ATRKGIATLAVVLGAFAACWLPFTVYCLLGDADSPRLYTYLTLLPATYNSMINPVIYAFR NQDVQKVLWAICCCCSTSKIPFRSRSPSDV
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Orphan receptor with constitutive G(s) signaling activity that activate cyclic AMP. Has a potential role in modulating a number of brain functions, including behavioral responses to stress, amyloid-beta peptide generation in neurons and neurite outgrowth. Maintains also meiotic arrest in oocytes.
Gene References into Functions
  1. These results demonstrate that GPR3 potentiates meiotic competence, most likely by raising cAMP. PMID: 29274320
  2. GPR3 appears to have a key role in the thermogenic response of interscapular brown adipose tissue and may represent a new therapeutic target in age-related obesity. PMID: 26455425
  3. This study found that the expression of GPR3 in CGNs exerted prosurvival effects against apoptosis-inducing stimuli, such as potassium deprivation, hypoxia, and ROS. PMID: 24769160
  4. Altered signalling pathways of GPR3 could contribute to the neurobiological substrate involved in developing addiction to cocaine PMID: 22612385
  5. Involvement of the orphan GPR3 receptor is demonstrated for the first time in expression and development of neuropathic pain and in analgesia induced by morphine. PMID: 21352831
  6. the GPR3 receptor is a link in communication between the somatic cells and oocyte of the ovarian follicle and is crucial for the regulation of meiosis PMID: 15591206
  7. Gpr3-defective mice may constitute a relevant model of premature ovarian failure due to early oocyte aging. PMID: 15956199
  8. GPR3 specifically in the oocyte, rather than in the follicle cells, is responsible for maintenance of meiotic arrest in mouse oocytes. PMID: 16289135
  9. GPR3-G(s) activation in response to stimulation of an exogenously expressed beta(2)-adrenergic receptor causes Galpha(s) to move from the oocyte plasma membrane into the cytoplasm. PMID: 17850783
  10. Gpr3 is epistatic to Pde3a and fertility as well as meiotic arrest in the PDE3A-deficient oocyte is dependent on the activity of GPR3. PMID: 18280465
  11. GPR3 qualifies as a new player in the modulation of behavioral responses to stress and constitutes a novel promising pharmacological target for treatment of emotional disorders PMID: 19259266
  12. GPR3 is a novel antiproliferative mediator of CGPs in the postnatal development of murine cerebellu PMID: 19526062

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed in both the forebrain and hindbrain, with the highest level in habenula. Lower level expression in the testis. Highly expressed in regions.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1