Recombinant Mouse Galanin receptor type 1(Galr1)

Code CSB-CF009223MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P56479
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MELAMVNLSEGNGSDPEPPAPESRPLFGIGVENFITLVVFGLIFAMGVLGNSLVITVLAR SKPGKPRSTTNLFILNLSIADLAYLLFCIPFQATVYALPTWVLGAFICKFIHYFFTVSML VSIFTLAAMSVDRYVAIVHSRRSSSLRVSRNALLGVGFIWALSIAMASPVAYHQRLFHRD SNQTFCWEQWPNKLHKKAYVVCTFVFGYLLPLLLICFCYAKVLNHLHKKLKNMSKKSEAS KKKTAQTVLVVVVVFGISWLPHHVVHLWAEFGAFPLTPASFFFRITAHCLAYSNSSVNPI IYAFLSENFRKAYKQVFKCHVCDESPRSETKENKSRMDTPPSTNCTHV
Source in vitro E.coli expression system
Gene Names Galr1
Protein Names Recommended name: Galanin receptor type 1 Short name= GAL1-R Short name= GALR-1
Expression Region 1-348
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for the hormone galanin. The activity of this receptor is mediated by G proteins that inhibit adenylate cyclase activity.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Expression is detected in brain, spinal cord, heart and skeletal muscle.
Database Links

KEGG: mmu:14427

STRING: 10090.ENSMUSP00000066381

UniGene: Mm.6219

Related Products

Galr1 Proteins

Galr1 Proteins for Mus musculus (Mouse)

Galr1 ELISA Kit

Galr1 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.