Recombinant Mouse Galanin receptor type 1 (Galr1)

Code CSB-CF009223MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Galr1; Galnr; Galnr1; Galanin receptor type 1; GAL1-R; GALR-1
Species
Mus musculus (Mouse)
Expression Region
1-348
Target Protein Sequence
MELAMVNLSEGNGSDPEPPAPESRPLFGIGVENFITLVVFGLIFAMGVLGNSLVITVLAR SKPGKPRSTTNLFILNLSIADLAYLLFCIPFQATVYALPTWVLGAFICKFIHYFFTVSML VSIFTLAAMSVDRYVAIVHSRRSSSLRVSRNALLGVGFIWALSIAMASPVAYHQRLFHRD SNQTFCWEQWPNKLHKKAYVVCTFVFGYLLPLLLICFCYAKVLNHLHKKLKNMSKKSEAS KKKTAQTVLVVVVVFGISWLPHHVVHLWAEFGAFPLTPASFFFRITAHCLAYSNSSVNPI IYAFLSENFRKAYKQVFKCHVCDESPRSETKENKSRMDTPPSTNCTHV
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for the hormone galanin. The activity of this receptor is mediated by G proteins that inhibit adenylate cyclase activity.
Gene References into Functions
  1. endogenous Gal-1 may influence T. cruzi infection by fueling tolerogenic circuits that hinder anti-parasite immunity. PMID: 26324777
  2. Experiments with a GalR1-preffering galanin analog, NAX-5055, show that GalR1 is involved in regulating glucose and insulin homeostasis PMID: 25690510
  3. two different models of chronic pain requires a galanin receptor 1-triggered depression of excitatory synaptic transmission in indirect pathway nucleus accumbens medium spiny neurons. PMID: 25082697
  4. GalR1 expression is increased in the nucleus accumbens after chronic restraint stress. PMID: 23639882
  5. Galanin receptor 1 deletion exacerbates hippocampal neuronal loss after systemic kainate administration in mice PMID: 21179451
  6. Rotavirus infection of murine small intestine causes colonic secretion via age restricted galanin-1 receptor expression. PMID: 20197068
  7. Homozygous Galr1-/- mice are viable, capable of breeding, and exhibit no significant difference in growth rate. They have reduced circulating levels of insulin-like growth factor-I (IGF-I) and exhibit spontaneous tonic-clonic seizures. PMID: 12487125
  8. The distribution of galanin receptor 1 messenger RNA in the mouse brain is abundantly expressed in many brain regions, including numerous hypothalamic and other forebrain regions associated with neuroendocrine function. PMID: 12605897
  9. The duration of pain-like behaviours is significantly increased in mice lacking the galanin receptor 1 gene (Galr1-/-) after photochemically induced partial sciatic nerve ischemic injury. PMID: 12605908
  10. Galanin receptor 1 knockout mice show increased anxiety-like behavior on the elevated plus-maze test, a finding that is consistent with the hypothesis that galanin exerts anxiolytic actions via the GAL-R1 receptor. PMID: 12700679
  11. GAL-R1 knockout mice are unimpaired on a number of tests of learning and memory with the exception of the trace version of cued fear conditioning. PMID: 15016096
  12. GalR1 mediate galanin protection from seizures and seizure-induced hippocampal injury in Li-pilocarpine and perforant-path- stimulation models of limbic status epilepticus, but not under conditions of kainic acid-induced seizures. PMID: 15350653
  13. Increased levels of GalR1 mRNA and galanin binding (attributed to GalR1) in the external granule cell layer at P10-12/(14) coincide with granule cell migration from the external to the inner granule cell layer. PMID: 15748163
  14. Changes in levels of GalR1 may play an important role in modulating signaling events and neuroplasticity underlying physiological functions of the locus coeruleus. PMID: 15934937
  15. mice lacking the GALR1 receptor (Galr1-/-) exhibited only slight increase in heat nociception in the hot plate, but not tail flick, test and showed no increase in spinal sensitization PMID: 15944013
  16. GalR1 knockout mice showed no difference with respect to acute nociception, but showed a modest tendency towards increased hyperalgesia after tissue injury and inflammation PMID: 15944015
  17. Knockout mice deficient in the GAL-R1 receptor subtype were normal on most memory tasks, while showing a small deficit in trace cued fear conditioning PMID: 15944016
  18. Taken together, these findings provide strong evidence that Gal(1) is a heteroreceptor expressed on excitatory glutamatergic dorsal horn interneurons. PMID: 16998907
  19. GALR1 deficiency impaired adaptation to a 3-day high-fat diet challenge, leading to increased food intake, feed efficiency and weight gain. PMID: 17223141
  20. Galr1 receptors inhibit vagal afferent mechanosensitivity in the gastro-esophageal afferent preparation. PMID: 17627995
  21. differential expression of Galr1 may contribute to the differences in susceptibility to seizure-induced cell death between cell death-resistant and cell death-susceptible strains PMID: 18363852
  22. In GalR1KO mice, a high dose of galanin failed to induce any of the above effects, suggesting the pivotal role of GalR1 in decreased locomotor activity and stress-resistant effects caused by galanin i.c.v. injection studied here. PMID: 19272414

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expression is detected in brain, spinal cord, heart and skeletal muscle.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1