Recombinant Mouse Gap junction beta-1 protein (Gjb1)

Code CSB-CF009451MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Gjb1
Uniprot No.
Alternative Names
Gjb1; Cxn-32; Gap junction beta-1 protein; Connexin-32; Cx32
Species
Mus musculus (Mouse)
Expression Region
1-283
Target Protein Sequence
MNWTGLYTLLSGVNRHSTAIGRVWLSVIFIFRIMVLVVAAESVWGDEKSSFICNTLQPGC NSVCYDHFFPISHVRLWSLQLILVSTPALLVAMHVAHQQHIEKKMLRLEGHGDPLHLEEV KRHKVHISGTLWWTYVISVVFRLLFEAVFMYVFYLLYPGYAMVRLVKCEAFPCPNTVDCF VSRPTEKTVFTVFMLAASGICIILNVAEVVYLIIRACARRAQRRSNPPSRKGSGFGHRLS PEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
Gene References into Functions
  1. The results of this study indicated that the Leu89Pro substitution in the second transmembrane domain of CX32 disrupts the trafficking of the protein, inhibiting the assembly of CX32 gap junctions, which in turn may result in peripheral neuropathy. PMID: 27367520
  2. We show that the cell-surface and secreted isoforms of CSF-1 have opposing effects on macrophage activation and disease progression in a mouse model of connexin32-deficientconnexin32-deficient mice PMID: 26865613
  3. Blockade of endothelial Cx32 increased tissue factor expression induced by TNF-alpha stimulation and cell-cell interaction via ICAM1. Direct Cx32-mediated interaction modulates TF expression in ECs during vascular inflammation. PMID: 25171777
  4. These findings support a role for Cx32 in non-myelinating and regenerating populations of Schwann cells in normal axonal maintenance in re-myelination, and regeneration of peripheral nerve following injury PMID: 25447941
  5. These results demonstrate that the incidence of hepatocellular carcinoma increases only in male Cx32KO mice, presumably due to enhanced tumor promotion and progression signals associated with Cx32 deficiency. PMID: 23001129
  6. Cx32 therapy improves gap junctional conductance results in larger infarct size, and no antiarrhythmic efficacy. PMID: 22374989
  7. Data show that absence of connexin30 in knockout mice changes the expression patterns of connexin26 and connexin32 in glial cells and leptomeninges. PMID: 22098503
  8. Cx32 can functionally replace Cx26 in the mouse cochlea resulting in almost normal hearing PMID: 21813206
  9. Induction of Cxs 29 and 32 in the injury border suggests that altered Cxs may contribute to the propagation of injury-related and/or regeneration signals after acute brain injury. PMID: 20926974
  10. oligodendrocyte-astrocyte gap junction coupling in Cx32 or Cx47 knockout mice. In corpus callosum, oligodendrocytes appeared to be directly coupled to other oligodendrocytes. O:O coupling was more affected in mice lacking Cx32 than in mice lacking Cx47. PMID: 21396451
  11. Asn(175) of Cx32 is a critical residue for heterotypic docking and functional gap junction channel formation between the Cx32 and Cx26 hemichannels. PMID: 21478159
  12. These findings suggest that altered Cx32 expression, a loss of intercellular Cx32 and a gain of intracytoplasmic Cx32 in the form of punctate "dot", plays an important role in the formation of gastric adenocarcinomas. PMID: 21082351
  13. Cx32 protects ECs from inflammation by regulating cytokine expression and plays an important role in the maintenance of vascular function PMID: 21036166
  14. oligodendrocytes in white matter form a functional syncytium predominantly among each other dependent on Cx47 and Cx32 expression, while astrocytic connexins expression can promote the size of this network PMID: 20468052
  15. An age-related increase in the number of macrophages in demyelinating nerves of Cx32-deficient mice suggests involvement of macrophages might be common in genetically-determined demyelination. PMID: 11849753
  16. Cx32 formation and/or Cx32-mediated intercellular communication induces expression and function of tight junctions in hepatocytes PMID: 11978007
  17. The direct calmodulin (CaM) role in chemical gating was tested with CaM mutants, and CaM-connexin 32 (Cx32) colocalization was demonstrated in the liver. PMID: 12064602
  18. Severe acute pancreatitis and reduced acinar cell apoptosis in the exocrine pancreas of mice deficient for the Cx32 gene. PMID: 12557153
  19. Expression profile of the Gjb1 in the developing mouse cochlea PMID: 12617848
  20. An increase in proliferating nestin+ and NG2+ oligodendrocyte progenitors in the subgranular zone, hilus, and polymorphonuclear layer of the dentate gyrus was noted in connexin32 deficient mice PMID: 12629180
  21. Cx47-deficient mice revealed a vacuolation of nerve fibers at the site of the optic nerve where axons are first contacted by oligodendrocytes and myelination starts; Cx32/Cx47-double-deficient mice developed action tremor and died ca 51 d after birth PMID: 12805295
  22. Mice lacking either Cx47 or Cx32 are viable but mice lacking both connexins die by postnatal week 6 from CNS myelin sheath abnormalities, vacuolation, enlarged periaxonal collars, oligodendrocyte cell death, and axonal loss PMID: 12843301
  23. Comparative mapping of Y1 and Y5 receptor subtypes within cell bodies and nerve fibers in the brain. Together with physiological and electrophysiological studies, provides better understanding of NPY neural circuitries. PMID: 12900929
  24. This study used freeze-fracture replica immunogold labeling to detect Cx32 in ultrastructurally defined gap junctions in Schmidt-Lanterman incisures, as well as in a novel location, between the outer two layers of internodal myelin PMID: 15056698
  25. Cx32 is localized on the outer membrane of large myelin sheaths PMID: 15293232
  26. The hepatic response to endotoxin is markedly impaired in the absence of Cx32. PMID: 15336523
  27. Connexin32 acts as a lung tumor suppressor in a mouse model. Cx32-deficient lung tissue exhibited an increased proliferative index, and, after exposure to diethylnitrosamine, Cx32-deficient mice exhibited a significant increase in lung tumor incidence. PMID: 15492231
  28. Cx32 expression is in part related to induction of tight junctions through modulation of Mag-1 expression in an immortalized hepatic cell line. PMID: 15558322
  29. Selective permeability of Cx43 junctions is regulated through protein kinase C (PKC)-dependent phosphorylation at serine 368 (S368). PMID: 16709897
  30. Findings indicate Cx43alpha1 may have a novel function in mediating crosstalk with cell signaling pathways that regulate polarized cell movement essential for the directional migration of CNCs. PMID: 16914489
  31. Cx43 KO mice showed continued Sertoli cell proliferation and delayed maturation in adulthood, indicating that CX43 plays key roles in Sertoli cell development PMID: 17229929
  32. In conclusion, neurodevelopment of Shuffler/Cx43 cKO mice is abnormal, and the observed cellular phenotype may explain behavioral disturbances seen in these animals as well as in humans carrying Cx43 mutations. PMID: 17311295
  33. Results indicate that Cx32 in wild-type mice protects hematopoietic stem cell from chemical abrasion and leukemogenic impacts. PMID: 17463168
  34. Connexin32-immunofluorescent puncta were essentially absent in suprachiasmatic nucleus PMID: 17904757
  35. Homomeric interactions of Cx29 and Cx32 require other domains: the N-terminus, transmembrane domains, and extracellular loops. Substituting the intracellular loop and/or tail of Cx32 with those of Cx29 prevents Cx32 from forming gap junctions. PMID: 17972320
  36. The data suggests that ablation of Cx43 in the oocyte and its decrease in surrounding somatic cells, allows normal oogenesis, folliculogenesis, ovulation and early embryonic development but severely impairs implantation of the resulting blactocysts. PMID: 18005958
  37. Connexin 43 was decreased in testis of mutant mice with impaired spermatogenesis. PMID: 18162455
  38. analysis of the atomistic model of the Cx32 connexon PMID: 18648547
  39. Glial growth factor 2, an isoform of neuregulin 1, up-regulated Cx32 in both proliferating and non-proliferating Schwann cells PMID: 19218461
  40. Cx32, which negatively controls thyroid growth activated by thyrotropin via the cAMP pathway, would act as a positive effector of thyroid growth triggered by oncogenes acting through other signaling cascades. PMID: 19509066
  41. The effects of metabolic inhibition on the calcium metabolizing activity of mouse connexin 32 hemichannels in stably transfected HeLa cells is reported. PMID: 19587218

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Protein Families
Connexin family, Beta-type (group I) subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1