Recombinant Mouse Gap junction gamma-3 protein (Gjc3)

Code CSB-CF842087MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Gjc3
Uniprot No.
Alternative Names
Gjc3; Cx29; Gje1; Gap junction gamma-3 protein; Connexin-29; Gap junction epsilon-1 protein
Species
Mus musculus (Mouse)
Expression Region
1-269
Target Protein Sequence
MLLLELPIKCRMCGRFLRQLLAQESQHSTPVGRFLLPMLMGFRLLILVSSGPGVFGNDEN EFICHLGQPGCKTICYDVFRPLSPLRFWAFQVILMAVPSAIYVAFTLYHVIGYWEVPGKE NKEQETQISKGDHSKDVSGAKSLKLLWAYVAHLGVRLALEGAALGVQYNLYGFKMSSTFI CREDPCIGSTTCFQSHPSEKTIFLNIMFGISGACFLFIFLELALLGLGRFWRIYKHKLSF LKKLPTSESSVRSKDTTDELSVVEAKEPF
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
Gene References into Functions
  1. Induction of Cxs 29 and 32 in the injury border suggests that altered Cx expression may contribute to the propagation of injury-related and/or regeneration signals after acute brain injury. PMID: 20926974
  2. Cx29 is a second connexin expressed in Schwann cells of sciatic nerve. PMID: 12372015
  3. Comparative mapping of Y1 and Y5 receptor subtypes within cell bodies and nerve fibers in the brain. Together with physiological and electrophysiological studies, provides better understanding of NPY neural circuitries. PMID: 12900929
  4. Cx29 is localized to the inner membrane of small myelin sheaths PMID: 15293232
  5. Our data first provide a comprehensive and detailed pattern of Cx29 gene expression in the mouse and rat cochlea. PMID: 16236250
  6. Thus, in contrast to connexin32 and connexin47, which are also expressed in myelinating cells, Cx29 does not contribute to the function of myelin in adult mice. PMID: 16435366
  7. Findings demonstrated the requirement of Cx29 for normal cochlear functions and suggest that Cx29 is a new candidate gene for studying the auditory neuropathy. PMID: 16481432
  8. Cx29 protein expression was absent from neural crest cells but appeared as neural crest cells generated precursors (embryonic day 12) both in vivo and in vitro. This identifies Cx29 as a novel marker for cells of the defined Schwann cell lineage. PMID: 17024657
  9. Homomeric interactions of Cx29 and Cx32 require other domains: the N-terminus, transmembrane domains, and extracellular loops. Substituting the intracellular loop and/or tail of Cx32 with those of Cx29 prevents Cx32 from forming functional gap junctions. PMID: 17972320
  10. Cx23 seems to share functional properties with pannexin (hemi) channels rather than gap junction channels of other connexins. PMID: 18849090

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Protein Families
Connexin family, Gamma-type subfamily
Tissue Specificity
CNS specific. Expression is restricted to brain, spinal cord, and sciatic nerve.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×