Recombinant Mouse Histamine H3 receptor (Hrh3)

Code CSB-CF010739MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Hrh3; Histamine H3 receptor; H3R; HH3R
Species
Mus musculus (Mouse)
Expression Region
1-445
Target Protein Sequence
MERAPPDGLMNASGALAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCAS SVFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMALVWVLAFLLYGPAILSWEYLSGG SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGGREAG PEPPPDAQPSPPPAPPSCWGCWPKGHGEAMPLHRYGVGEAGPGVETGEAGLGGGSGGGAA ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSITQRFRLSRDKKVAKSL AIIVSIFGLCWAPYTLLMIIRAACHGHCVPDYWYETSFWLLWANSAVNPVLYPLCHYSFR RAFTKLLCPQKLKVQPHGSLEQCWK
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
The H3 subclass of histamine receptors could mediate the histamine signals in CNS and peripheral nervous system. Signals through the inhibition of adenylate cyclase and displays high constitutive activity (spontaneous activity in the absence of agonist).
Gene References into Functions
  1. The H3 receptor in the dorsal striatum is a contributor to repetitive behavioral pathology. PMID: 28117842
  2. H3R activation with the agonist R-(-)-alpha-methylhistamine to produce a unique time- and cell type-dependent profile of molecular signaling events in the striatum. PMID: 27510032
  3. H3R is an important regulator of sensorimotor gating, and the lack of H3R significantly modifies striatal dopaminergic PMID: 26945087
  4. Data show that knockout of histamine receptor H3 (Hrh3 receptor) caused a substantial reduction of free-running activity rhythm amplitude. PMID: 26660098
  5. These results suggest that H3 receptor may participate in the maintenance of the relaxed state and prevention of over-contraction in mature differentiated myotubes. PMID: 25746421
  6. Histamine H3 receptors were expressed in mouse beta cells and could play a role in insulin secretion and, possibly, beta cell proliferation. PMID: 24117016
  7. Hrh3 polymorphisms between EAE-susceptible and resistant SJL and B10.S mice PMID: 23894272
  8. Greater slow wave sleep increases are found in histamine H3 knock-out mice compared to wild-type mice, consistent with enhanced histamine transmission. PMID: 23303066
  9. ZEL-H16 is a novel and potent nonimidazole agonist of H3R, which might serve as a pharmacological tool for future investigations or as possible therapeutic agent of H3R. PMID: 22870296
  10. Evidence for the role of histamine H3 receptor was found in alcohol-related behaviors, especially in alcohol drinking and alcohol reward. PMID: 21654737
  11. An increased expression of H3 receptors in HDC KO mice without any changes in the spontaneous firing of "histaminergic" neurons without histamine and their responses to the H3 receptor agonist (R)-alpha-methylhistamine. PMID: 21710252
  12. These findings demonstrate that manipulation of central histamine H3 receptor by proxyfan can significantly improve glucose excursion by increasing plasma insulin levels via a glucose-independent mechanism. PMID: 21239440
  13. D(1)-H(3) receptor heteromers work as processors integrating dopamine- and histamine-related signals involved in controlling the function of striatal neurons of the direct striatal pathway. PMID: 21173143
  14. In this review conditioned place preference induced by alcohol is stronger in histidine decarboxylase-deficient mice than in control mice. PMID: 20864504
  15. Methamphetamine- and MDMA-induced behavioral changes in Hrh3 knockout mice are reported. PMID: 19783867
  16. The aim of this work was to investigate the effects of essential splice signals on intron retention in histamine H3 receptors and to identify sequence elements that determine the differences in splicing between rats and mice. PMID: 19446035
  17. These results suggest that neuronal histamine is a mediator of body-weight homeostasis and that neuronal histamine functions through H3 receptors in mice. PMID: 12488429
  18. Norepinephrine release from the ischemic heart is greatly enhanced in mice lacking histamine H3 receptors. PMID: 12527809
  19. Data support a protective antiarrhythmic role of histamine H(3)-receptors in myocardial ischemia. PMID: 12810089
  20. These findings support a role for H3Rs in mediating histamine effects on spatial learning and memory and measures of anxiety. PMID: 15078574
  21. Histamine H3 receptor activation hyperpolarized substantia nigra pars reticulata and thus decreasing the intensity of basal ganglia output. [histamine h3 receptor] PMID: 16738217
  22. brain H3Rs play a pivotal role in drinking behavior in response to dehydration and AT-II PMID: 16887177
  23. Central Hrh3 signaling negatively regulates susceptibility to autoimmune inflammatory disease of the CNS. PMID: 17548817
  24. These results indicate distinctive roles of histamine H(3) receptors in various orexigenic pathways PMID: 18037404
  25. Report participation of histamine H3 receptors in experimental allergic rhinitis of mice. PMID: 18845911
  26. Histamine H(3) receptor-mediated signaling protects mice from cerebral malaria PMID: 19547708
  27. H3R stimulation could have a neuroprotective effect that may help in understanding the impact of H3R signaling in the central nervous system. PMID: 19549072
  28. H3 protein expression was found in vestibular neurons of mice characterized by large and roundish soma, which labeled for calretinin and calbindin. PMID: 19563635

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1