Recombinant Mouse Histamine H4 receptor (Hrh4)

Code CSB-CF842068MO
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Hrh4
Uniprot No.
Alternative Names
Hrh4; Histamine H4 receptor; H4R; HH4R
Species
Mus musculus (Mouse)
Expression Region
1-391
Target Protein Sequence
MSESNSTGILPPAAQVPLAFLMSSFAFAIMVGNAVVILAFVVDRNLRHRSNYFFLNLAIS DFLVGLISIPLYIPHVLFNWNFGSGICMFWLITDYLLCTASVYNIVLISYDRYQSVSNAV SYRAQHTGIMKIVAQMVAVWILAFLVNGPMILASDSWKNSTNTKDCEPGFVTEWYILTIT MLLEFLLPVISVAYFNVQIYWSLWKRRALSRCPSHAGFSTTSSSASGHLHRAGVACRTSN PGLKESAASRHSESPRRKSSILVSLRTHMNSSITAFKVGSFWRSESAALRQREYAELLRG RKLARSLAILLSAFAICWAPYCLFTIVLSTYPRTERPKSVWYSIAFWLQWFNSFVNPFLY PLCHRRFQKAFWKILCVTKQPALSQNQSVSS
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
The H4 subclass of histamine receptors could mediate the histamine signals in peripheral tissues. Displays a significant level of constitutive activity (spontaneous activity in the absence of agonist).
Gene References into Functions
  1. colonic mast cells-derived histamine initiates granulocyte infiltration into the colonic mucosa through H4R PMID: 29363669
  2. This study demonstrated that the phenotype of H4R(-)/(-) mice leads to increased neuropathic pain hypersensitivity promoting an overactivation of spinal ERK-CREB pathway in DbetaH expressing neurons without modifying the innervation of the hind paw skin and integrity of the primary sensory neurons. PMID: 29107625
  3. H4R ligands have a beneficial effect in a model of lung fibrosis in the mouse, thus indicating that H4R antagonists or inverse agonists could be a novel therapeutic strategy for lung inflammatory diseases. PMID: 27475884
  4. Results illustrate that histamine H4 receptors (H4R) modulates various neurophysiological functions such as locomotor activity, anxiety, nociception and feeding behaviour, confirming the importance of the integrity and functionality of neuronal H4R in the histaminergic regulation of neuronal functions. PMID: 27899280
  5. These results identify the H4R as a new target controlling NK cell migration and NK cell-dendritic cell interaction in the skin during early allergic inflammation. These results further suggest that blocking the H4R in the skin might be beneficial in diseases like atopic dermatitis. PMID: 27155791
  6. Histamine H4 receptor knockout mice display reduced inflammation in a chronic model of atopic dermatitis PMID: 26440543
  7. H4 receptor expression plays a role in pathological vessel leakage associated with choroidal neovascularization PMID: 24787705
  8. These results indicate a proinflammatory role of histamine via H4R in inflammatory bowel disease. PMID: 26365468
  9. Functional H4 receptors increasing (35)S-GTPgammaS binding and/or decreasing noradrenaline release are not found in human, guinea pig or mouse cortex PMID: 25300787
  10. in experimental asthma in mice the H4 receptor specifically regulates activation of dendritic cells during sensitization, while in the effector phase the H4 receptor is active in cells involved in the activation of eosinophils, and possibly other cells. PMID: 25501767
  11. involved in the pathogenesis and progression of rheumatoid arthritis PMID: 24402309
  12. These results reveal a crucial role for H1- and H4-receptors for Th2 migration and cytokine secretion in a Th2-driven model of skin inflammation. PMID: 24503582
  13. the role of H4 receptors in immune disease is context-specific, depending on the animal model used and the complement of H4 receptor-expressing cells; H4 receptor blockade was detrimental in experimental autoimmune encephalomyelitis PMID: 23735232
  14. The histamine H4 receptor mediates inflammation and Th17 responses in preclinical models of arthritis. PMID: 24126456
  15. H4R expression on murine keratinocytes was detected after stimulation with LPS and peptidoglycan. PMID: 23932072
  16. HR4 is most important for the development of rheumatoid arthritis. PMID: 23545338
  17. the present study shows that H4 receptors potentially play a role in IgE induced FcepsilonRI upregulation PMID: 23850674
  18. Acting via its H4 receptors, histamine impedes lipopolysaccharide-induced microglia migration and interleukin (IL)-1beta release under inflammatory challenge. PMID: 22569158
  19. development of allergic rhinitis proceeded in two distinct stages: histamine release from FcepsilonRI-activated mast cells, followed by histamine-mediated recruitment of H(4)R-expressing basophils to the nasal cavity and activation through FcepsilonRI. PMID: 23241885
  20. analysis of fragment optimization and analysis of binding kinetics for ligand based design of novel histamine H receptor antagonists PMID: 22153663
  21. The majority of hypertrophic ATDC5 chondrocytes express H4R, suggesting that this receptor is associated with the differentiation of chondrocytes into hypertrophic cells. PMID: 22065367
  22. Data suggest that a combined pharmacological targeting of histamine H(1) and H(4) receptors could be taken into consideration as an option for the prevention of asthma and maybe other allergic diseases. PMID: 22272324
  23. Histamine Hrh4-deficient mice, despite having equivalent T effector cell responses, develop more severe allergic encephalomyelitis, augmented neuroinflammation, and increased blood-brain barrier permeability compared with wild-type mice. PMID: 22147765
  24. enhances LPS-induced IL-6 production in mast cells PMID: 21469095
  25. Langerhans cells express a functional H(4)R and point towards a possible pathogenic relevance of the H(4)R in inflammatory and allergic diseases. PMID: 19958313
  26. Therapeutic H4R antagonism can significantly ameliorate allergen induced, Th2 cytokine driven pathologies such as lung remodeling and airway dysfunction in asthma. PMID: 20573261
  27. a sudy of the expression of H4R protein in mice and its possible role in dendritic cell function namely antigen presentation PMID: 19997860
  28. Utilising A new immunological probe, new evidence is provided for oligomeric mH(4)Rs and the presence of H(4) receptors on a subpopulation of murine motor neurons PMID: 20020316
  29. Superinduction of the histamine H(4) receptor gene in the spleen is transcriptionally controlled by NF-kappa B; stimulation of this receptor is involved in sepsis-induced splenic apoptosis through counteraction of the antiapoptotic action of NF-kappaB. PMID: 20008488
  30. The effect of H(4)R antagonism on dendritic cell migration in vivo may be an indirect result of the reduction in tissue cytokines and chemokines or a direct effect on chemotaxis PMID: 19907432
  31. show that progenitor cell populations express this receptor subtype on transcriptional and protein levels and respond to its agonists by reduced growth factor-induced cell cycle progression that leads to decreased myeloid, erythroid and lymphoid formation PMID: 19662098
  32. Histamine H4 receptor mediates chemotaxis and calcium mobilization of mast cells. PMID: 12626656
  33. Mouse eosinophils express H4. CCL16 induced pertussis toxin-sensitive calcium mobilization and chemotaxis only in murine L1.2 cells expressing H4. PMID: 15265943
  34. We investigated the potential role of H4R in development of allergic asthma in a murine model. PMID: 17548646
  35. Results describe hepatic gene expression in genetically histamine H4 receptor deficient mice in normal and inflammatory conditions. PMID: 17806177
  36. Phenylalanine 169 in the second extracellular loop of the human histamine H4 receptor is responsible for the difference in agonist binding between human and mouse H4 receptors. PMID: 18635748
  37. Histamine-induced functional recovery of invariant natural killer (NK)T cells in histamine-free histidine decarboxylase-deficient mice is mediated mainly through the histamine H4 receptor. PMID: 19155466
  38. Role of histamine H(4) receptor in allergic conjunctivitis in mice is presented. PMID: 19249296
  39. Histamine H4 receptors are functionally expressed on neurons, which has major implications for the therapeutic potential of these receptors in neurology and psychiatry. PMID: 19413571

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X