Recombinant Mouse Integral membrane protein 2B (Itm2b)

Code CSB-CF011904MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Itm2b
Uniprot No.
Alternative Names
Itm2b; Integral membrane protein 2B; Immature BRI2; imBRI2; Protein E25B; Transmembrane protein BRI; Bri
Species
Mus musculus (Mouse)
Expression Region
1-266
Target Protein Sequence
MVKVTFNSALAQKEAKKDEPKSSEEALIVPPDAVAVDCKDPGDVVPVGQRRAWCWCMCFGLAFMLAGVILGGAYLYKYFALQPDDVYYCGLKYIKDDVILNEPSADAPAARYQTIEENIKIFEEDAVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPKNLLELLINIKAGTYLPQSYLIHEHMVITDRIENVDNLGFFIYRLCHDKETYKLQRRETIRGIQKREASNCFTIRHFENKFAVETLICS
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a regulatory role in the processing of the amyloid-beta A4 precursor protein (APP) and acts as an inhibitor of the amyloid-beta peptide aggregation and fibrils deposition. Plays a role in the induction of neurite outgrowth. Functions as a protease inhibitor by blocking access of secretases to APP cleavage sites.; Mature BRI2 (mBRI2) functions as a modulator of the amyloid-beta A4 precursor protein (APP) processing leading to a strong reduction in the secretion of secretase-processed amyloid-beta protein 40 and amyloid-beta protein 42.; Bri23 peptide prevents aggregation of APP amyloid-beta protein 42 into toxic oligomers.
Gene References into Functions
  1. Data indicate that double transgenic (Tg-FDD-Tau) mice showed a significant decrease in synaptophysin levels. PMID: 23418567
  2. BRI2 protein regulates beta-amyloid degradation by increasing levels of secreted insulin-degrading enzyme (IDE). PMID: 21873424
  3. Suggest that Adam7 functions in fertilization through the formation of a complex with heat shock protein 5, calnexin and Itm2b during capacitation in sperm. PMID: 20945367
  4. The shor form of ITM2B induces apoptosis in IL-2-stimulated cells. The long form can't induce it. ITM2B(s) interacts with Bcl-2, but not with Bad. Mutation of the L and D residues in the BH3 domain abolished the ability of ITM2B(s) to promote apoptosis. PMID: 12082633
  5. ITM2B(S) induces apoptosis via a caspase-dependent mitochondrial pathway. PMID: 12442332
  6. BH3-only protein ITM2Bs is able to induce apoptotic cell death in p53+/+, as well as in p53-/- cell lines. PMID: 14741382
  7. Itm2b mRNA was differentially expressed in mouse male reproductive tissues, during sexual maturation and up-regulated by testosterone. PMID: 17873332

Show More

Hide All

Subcellular Location
[Integral membrane protein 2B]: Golgi apparatus membrane; Single-pass type II membrane protein.; [BRI2, membrane form]: Cell membrane; Single-pass type II membrane protein. Endosome membrane; Single-pass type II membrane protein.; [Bri23 peptide]: Secreted.; [BRI2C, soluble form]: Secreted.
Protein Families
ITM2 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1