Recombinant Mouse KiSS-1 receptor (Kiss1r)

Code CSB-CF842011MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Kiss1r; Gpr54; KiSS-1 receptor; KiSS-1R; G-protein coupled receptor 54; G-protein coupled receptor OT7T175; mOT7T175; Kisspeptins receptor; Metastin receptor
Species
Mus musculus (Mouse)
Expression Region
1-396
Target Protein Sequence
MATEATLAPNVTWWAPSNASGCPGCGVNASDDPGSAPRPLDAWLVPLFFATLMLLGLVGN SLVIYVICRHKHMQTVTNFYIANLAATDVTFLLCCVPFTALLYPLPAWVLGDFMCKFVNY IQQVSVQATCATLTAMSVDRWYVTVFPLRALHRRTPRLALAVSLSIWVGSAAVSAPVLAL HRLSPGPRTYCSEAFPSRALERAFALYNLLALYLLPLLATCACYGAMLRHLGRAAVRPAP TDGALQGQLLAQRAGAVRTKVSRLVAAVVLLFAACWGPIQLFLVLQALGPSGAWHPRSYA AYAVKIWAHCMSYSNSALNPLLYAFLGSHFRQAFCRVCPCCRQRQRRPHTSAHSDRAATH TVPHSRAAHPVRIRSPEPGNPVVRSPCAQSERTASL
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for metastin (kisspeptin-52 or kp-52), a C-terminally amidated peptide of KiSS1. KiSS1 is a metastasis suppressor protein. Activation of the receptor inhibits cell proliferation and cell migration, key characteristics of tumor metastasis. The receptor is essential for normal gonadotropin-released hormone physiology and for puberty. The hypothalamic KiSS1/KISS1R system is a pivotal factor in central regulation of the gonadotropic axis at puberty and in adulthood. Analysis of the transduction pathways activated by the receptor identifies coupling to phospholipase C and intracellular calcium release through pertussis toxin-insensitive G(q) proteins.
Gene References into Functions
  1. G-protein coupled receptor 54 (GPR54) deficiency leads to elevated experimental autoimmune encephalomyelitis (EAE) disease severity independent of the reproductive axis. GPR54 deficiency leads to impaired immunotolerance in association with reduced number of Regulatory T-Lymphocytes, increased T-cell activation, and altered thymocyte subsets. PMID: 29931449
  2. while uterine growth was fully rescued by E2 treatment of Kiss1(-/-) mice and by genetic restoration of kisspeptin signaling in GnRH neurons in Kiss1r(-/-) mice, functional adenogenesis was only marginally restored. Thus, while uterine growth is largely dependent on ovarian E2-output via central kisspeptin signaling, peripheral kisspeptin signaling is indispensable for endometrial adenogenesis and function PMID: 27364226
  3. Study found unaltered hypothalamic metabolic gene expression in Kiss1 receptor knockout mice despite obesity and reduced energy expenditure. PMID: 27601011
  4. Nesfatin-1 increased Kiss1R expression in hypothalamic cells. PMID: 28339602
  5. Kisspeptin-10 may contribute to accelerate the progression and instability of atheromatous plaques, leading to plaque rupture. The GPR54 antagonist may be useful for prevention and treatment of atherosclerosis. PMID: 28411243
  6. data suggest the utility of the KISS1R as a novel biomarker for multiple myeloma, capable of targeting both tumor cells and host cells of the tumor microenvironment PMID: 27158817
  7. kiss1 and kiss1r mRNA levels were significantly higher in old compared to reproductive-aged mice, and diet-induced obesity did not alter kiss1 or kiss1r mRNA levels. Compared to young control mice, young MCP-1 knockout mice had significantly lower ovarian kiss1 mRNA PMID: 26879207
  8. On D4 of pregnancy, the mouse uterus expresses a functional kisspeptin/KISS1R signaling system. PMID: 26384646
  9. Gnaq was selectively inactivated in GnRH neurons of global Gna11--null mice, but they still responded to kisspeptin, confirming that KISS1R signals via non-Galphaq/11-coupled pathways. PMID: 26377475
  10. orchestrated onset of kisspeptin and GPR54 expression in the male embryonic brain at embryonic day 13.5 PMID: 26172029
  11. Results demonstrate defective negative feedback in global Gpr54-null mice that cannot be attributed to a lack of prior exposure of the gonadotropin-releasing hormone neuronal network to cyclical estradiol PMID: 25301053
  12. Expression of Kiss1 and Gpr54 was confirmed in mouse placenta but no differences in birth weight were found in mice that had been supported by a mutant placenta during fetal development. PMID: 25468546
  13. Kiss1/GPR54 system is involved in promoting uterine decidualization during early pregnancy in mice PMID: 24830702
  14. Kiss1r in GnRH neurons is critical for reproductive development and fertility. PMID: 24422632
  15. kisspeptin-1 and Kiss1r signaling influences BW, energy expenditure, and glucose homeostasis in a sexually dimorphic and partially sex steroid-independent manner PMID: 24937427
  16. kisspeptin receptor (Kiss1r), a GPCR that is activated by kisspeptin to regulate the onset of puberty and adult reproductive function, is enriched in cilia projecting from mouse PMID: 24982149
  17. Oocytes fail to respond to gonadotropins with increased trk-B tyrosine kinase (Ntrk)2 expression in the absence of KISS1R PMID: 24877631
  18. Failure of follicular development and ovulation linked to the absence of Kiss1r cannot be fully rescued by (even extended) gonadotropin replacement. PMID: 24885574
  19. Most GnRH neurons in the embryonic arcuate nucleus express kisspeptin receptor GPR54 upon circuit formation. PMID: 24599473
  20. The GnRH neuron is the key site of kisspeptin-Gpr54 signaling for fertility. PMID: 24051579
  21. kisspeptin regulates gonadotropin gene expression through the activation of Kiss1R signaling through protein kinase C, inducing immediate early genes in vitro. PMID: 23770611
  22. Gonadal steroids are essential for the induction of kisspeptin expression in the rostral periventricular area of the third ventricle during pubertal development in the male mouse. PMID: 22340076
  23. It was concluded that elevated testosterone secretion in prenatal and neonatal mice is independent of both kisspeptin and GnRH signaling, and the necessity of kisspeptin-Kiss1r signaling for testicular function is first apparent after d 5. PMID: 22202164
  24. Data suggest a possible mechanism whereby GPR54 expression levels, and thus GnRH sensitivity to kisspeptin, may change dramatically over the pro-oestrous day. PMID: 21756268
  25. Kiss1r attenuation was sufficient to delay breast tumor initiation, progression, and metastasis through inhibitory effects on the downstream Galphaq-p63RhoGEF-RhoA signaling pathway. PMID: 21852382
  26. loss of GPR54 and kisspeptin are not fully equivalent in the mouse hypothalamus PMID: 21527035
  27. Data show that female mice lacking neurons that express the kisspeptin receptor GPR54 were fertile. PMID: 21516099
  28. Gpr54-/- mice show more pronounced defects in spermatogenesis than Kiss1-/- mice and improved spermatogenesis with age when exposed to dietary phytoestrogens. PMID: 21156837
  29. GPR54 regulates ERK1/2 activity and hypothalamic gene expression in a Galpha(q/11) and beta-arrestin-dependent manner. PMID: 20886089
  30. Gpr54 regulates Bmp7 expression through NFAT2 and Sp1 and plays an important role in embryonic kidney branching morphogenesis and glomerular development PMID: 20375015
  31. transcription factor SP1 binds directly to the mGPR54 promoter region and activates gene expression. PMID: 20152817
  32. Kiss1(-/-) and Gpr54(-/-) mice retain some degree of gonadotrophin-releasing hormone activity, which is sufficient to effect vaginal cytology and uterine weights in female mice and on spermatogenesis and testicular weights in male mice. PMID: 19840236
  33. A complex temporal and spatial pattern of Gpr54 gene expression in developing GnRH neurons. PMID: 19966188
  34. Mutations in GPR54 cause autosomal recessive idiopathic hypogonadotropic hypogonadism in humans and mice, suggesting that this receptor is essential for normal gonadotropin-releasing hormone physiology and for puberty. PMID: 14573733
  35. The analysis of the GPR54 mutant mice revealed developmental abnormalities of both male and female genitalia and histopathological changes in tissues which normally contain sexually dimorphic features. PMID: 14652023
  36. The localization and GnRH release effects of kisspeptin thus define GPR54 as a major control point in the reproductive axis and suggest kisspeptin to be a neurohormonal effector. PMID: 15665093
  37. Kisspeptin exerts a potent depolarizing effect on the excitability of almost all adult gonadotropin-releasing hormone (GnRH) neurons. Responsiveness of GnRH neurons to kisspeptin increases over postnatal development. PMID: 16339030
  38. Leptin infusion of ob/ob mice evoked a significant increase in KiSS-1 and GPR54 mRNA levels. PMID: 17595226
  39. Both Kiss1 and Gpr54 knockout mice have abnormal sexual maturation consistent with hypogonadotropic hypogonadism, although Kiss1 knockout mice appear to be less severely affected than their receptor counterparts. PMID: 17595229
  40. that GnRH receptor/GnRH and GPR54/kisspeptin autoregulatory systems are integrated by negative feedback to regulate GnRH and kisspeptin secretion from GnRH neurons PMID: 17698953
  41. GPR54 is necessary for proper male-like development of several sexually dimorphic traits, likely by regulating GnRH-mediated androgen secretion during "critical windows" in perinatal development. PMID: 17699664
  42. kisspeptin-10 can significantly stimulate gonadotropin-releasing hormone (GnRH) release and GnRH mRNA expression in neurosecretory GT1-7 cells. PMID: 17728535
  43. in mice, kisspeptin-GPR54 signaling is required for the tonic stimulation of GnRH/LH secretion but is not required for generating the E-induced GnRH/LH surge. PMID: 17978050
  44. A potent stimulating effect of Kisspeptin at GnRH nerve terminals in the mediobasal hypothalamus of the mouse. PMID: 18450966
  45. kisspeptin activates G protein-coupled receptor 54 (GPR54) to initiate a PLC-IP3R-calcium cascade that modulates ions channels to initiate depolarization in GnRH neurons. PMID: 18483150

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Highest level in the heart and 15- and 17-day embryos. Low level in other tissues. Colocalized with gonadotropin-releasing hormone (GnRH) neurons in the hypothalamus.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1