Recombinant Mouse Lanosterol 14-alpha demethylase (Cyp51a1)

Code CSB-CF809073MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Cyp51a1; Cyp51; Lanosterol 14-alpha demethylase; LDM; CYPLI; Cytochrome P450 51A1; Cytochrome P450-14DM; Cytochrome P45014DM; Cytochrome P450LI; Sterol 14-alpha demethylase
Species
Mus musculus (Mouse)
Expression Region
1-503
Target Protein Sequence
MVLLGLLQSGGWVLGQAMEQVTGGNLLSTLLIACAFTLSLVYLFRLAVGHMVQLPAGAKS PPHIYSPIPFLGHAIAFGKSPIEFLENAYEKYGPVFSFTMVGKTFTYLLGSDAAALLFNS KNEDLNAEEVYGRLTTPVFGKGVAYDVPNAIFLEQKKIIKSGLNIAHFKQYVPIIEKEAK EYFQSWGESGERNVFEALSELIILTASHCLHGKEIRSQLNEKVAQLYADLDGGFTHAAWL LPAWLPLPSFRRRDRAHREIKNIFYKAIQKRRLSKEPAEDILQTLLDSTYKDGRPLTDEE ISGMLIGLLLAGQHTSSTTSAWMGFFLAKDKPLQEKCYLEQKAVCGEDLPPLTYDQLKDL NLLDRCIKETLRLRPPIMTMMRMAKTPQTVAGYTIPPGHQVCVSPTVNQRLKDSWAERLD FNPDRYLQDNPASGEKFAYVPFGAGRHRCVGENFAYVQIKTIWSTMLRLYEFDLINGYFP TVNYTTMIHTPENPVIRYKRRSK
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
A cytochrome P450 monooxygenase involved in sterol biosynthesis. Catalyzes 14-alpha demethylation of lanosterol and 24,25-dihydrolanosterol likely through sequential oxidative conversion of 14-alpha methyl group to hydroxymethyl, then to carboxylaldehyde, followed by the formation of the delta 14,15 double bond in the sterol core and concomitant release of formic acid. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (CPR; NADPH-ferrihemoprotein reductase).
Gene References into Functions
  1. we identify a global and sex-dependent transcriptional de-regulation due to the block in cholesterol synthesis during development of the Cyp51 knockout mice and provide in vivo evidence that sterol intermediates downstream of lanosterol may regulate the hepatic RORC activity. PMID: 28098217
  2. CYP51 is a mediator of T3 and FSH-induced follicular development. PMID: 28938463
  3. Our Cyp51 LKO model shows that steatosis appears with dietary fats in the absence of dietary cholesterol and its synthesis, while a block in the cholesterol pathway leads to NASH-like features PMID: 25739789
  4. germ cell-specific ablation of Cyp51, leading to lack of MAS, did not affect testicular morphology, daily sperm production, or reproductive performance in males. PMID: 23509403
  5. Cyp51 knock-out mice provide evidence that Cyp51 is essential for embryogenesis and present a potential animal model for studying ABS syndrome in humans. PMID: 21705796
  6. Findings suggest that FSH, partially at least, employs CYP51, and therefore the MAS pathway, to initiate oocyte meiosis. PMID: 19433477
  7. localization of CYP51 in testis and ovary shows Leydig cells and acrosomes of spermatids express the highest levels PMID: 11988326
  8. Demethylation of lanosterol to FF-MAS by the acrosomal lanosterol 14 alpha-demethylase enzyme complex demonstrates for the first time the ability of ejaculate sperm to synthesize meiosis-activating sterols. PMID: 14630712
  9. A gene participating in cholesterol bisynthesis (CYP51) is regulated in an immediate early fashion, which influences sterol profile of the cell. PMID: 16123160
  10. there was a cholesterol levels link-modulation system between cholesterol synthetic pathway through CYP51 and cholesterol transport pathway through , low-density lipoprotein receptor in vivo PMID: 18520052
  11. These data indicate that Crem-dependent regulation of Cyp51 in the liver results in circadian expression of this gene. PMID: 18775413
  12. Lanosterol 14alpha-demethylase (LDM) is closely related to mouse embryo implantation and can be upregulated by oestrogen. PMID: 19007561

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Microsome membrane; Single-pass membrane protein.
Protein Families
Cytochrome P450 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1