Recombinant Mouse Leukotriene B4 receptor 2 (Ltb4r2)

Code CSB-CF013222MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Ltb4r2; Blt2; Leukotriene B4 receptor 2; LTB4-R 2; LTB4-R2; Leukotriene B4 receptor BLT2
Species
Mus musculus (Mouse)
Expression Region
1-360
Target Protein Sequence
MSVCYRPPGNETLLSWKGSRATGTAFLLLAALLGLPGNGFVVWSLAGWRPTAGRPLAATL VLHLALADGAVLLLTPLFVAFLSQEAWPLGQVGCKAVYYVCALSMYASVLLTGLLSLQRC LAVTRPFLAPRLRSPALARRLLLGVWLAALVLAVPAAVYRHLWGGRVCQLCHPSPVHAAA HLSLETLTAFVLPFGTVLGCYGVTLARLRGARWGSGRQGTRVGRLVSAIVLAFGLLWAPY HAVNLLQAVAALAPPEGPLARLGGAGQAARAGTTALAFFSSSVNPVLYVFTAGDLLPRAG PRFLTRLFEGSGEARGGSRSREGTMELRTTPKLKVMGQGRGNGDPGGGDGGKTEKDSQEW
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Low-affinity receptor for leukotrienes including leukotriene B4. Mediates chemotaxis of granulocytes and macrophages. The response is mediated via G-proteins that activate a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
  1. FABP4 regulates the expression of BLT1R and its downstream signaling via control of oxidative stress in macrophages PMID: 28546450
  2. This study demonstrates that LTB4 promotes macrophage phagocytosis of bacteria via BLT1, and that BLT2 can fulfill this role in the absence of BL PMID: 28053185
  3. the data show that the two leukotriene B4 receptors have opposing roles in the sensitization of peripheral sensory neurons forming a self-restricting system. PMID: 28242764
  4. These results show that 12-HHT/BLT2 enhances epithelial barrier function by increasing CLDN4 expression via the Galphai protein-p38 MAPK pathway. PMID: 26527063
  5. Data indicate that leukotriene B4 receptor 2 protein BLT2-deficient mice exhibited impaired re-epithelialization and delayed wound closure after skin punching. PMID: 24821912
  6. Findings indicate that BLT2 has a protective role in allergic airway inflammation and that diminished BLT2 expression in CD4(+) T cells may contribute to the pathophysiology of asthma. PMID: 23603839
  7. Selective inhibition of the BLT2 receptor in mice reduces the release of vascular reactive oxygen species and improves endothelial function in mice PMID: 21755457
  8. Results suggest a direct anti-inflammatory role of BLT2 that is distinct from the proinflammatory roles of BLT1. PMID: 20667973
  9. our results suggest that the BLT2-Nox1-reactive oxygen species cascade is a previously unsuspected mediatory signaling mechanism to Th2 cytokine production in Ag-stimulated BMMCs PMID: 20952677
  10. BLT2-deficient mice develop normally; analysis of immune cells shows that disruption of BLT2 does not alter BLT1 expression or function. PMID: 20656922
  11. BLT2 plays a pivotal, mediatory role in the pathogenesis of asthma, acting through a "reactive oxygen species-NF-kappaB"-linked inflammatory signaling pathway. PMID: 19448154
  12. 360 amino acid sequence determined and aligned with human sequence PMID: 12895595
  13. BLT2 is a leukotriene B4 receptor with a role in ERK activation and cell migration of primary mouse keratinocytes PMID: 15866883
  14. demonstrates expression of functional Leukotriene B4 receptors, both BLT1 and BLT2, in murine and human mast cells and a regulatory role for stem cell factor in their expression PMID: 16920986
  15. 12-HHT is a natural lipid agonist of BLT2 in vivo and induces chemotaxis of mast cells PMID: 18378794
  16. The BLT2 receptor is involved in 12(S)-lipoxygenase-product-induced scratching in ICR mice. PMID: 18536755

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1