Recombinant Mouse Lutropin-choriogonadotropic hormone receptor (Lhcgr)

Code CSB-CF012911MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Lhcgr; Lhr; Lutropin-choriogonadotropic hormone receptor; LH/CG-R; Luteinizing hormone receptor; LSH-R
Species
Mus musculus (Mouse)
Expression Region
27-700
Target Protein Sequence
PELSGSRCPEPCDCAPDGALRCPGPRAGLARLSLTYLPVKVIPSQAFRGLNEVVKIEISQ SDSLERIEANAFDNLLNLSEILIQNTKNLLYIEPGAFTNLPRLKYLSICNTGIRTLPDVS KISSSEFNFILEICDNLYITTIPGNAFQGMNNESITLKLYGNGFEEVQSHAFNGTTLISL ELKENIYLEKMHSGTFQGATGPSILDVSSTKLQALPSHGLESIQTLIATSSYSLKTLPSR EKFTSLLVATLTYPSHCCAFRNLPKKEQNFSFSIFENFSKQCESTVREANNETLYSAIFE ENELSGWDYDYDFCSPKTLQCTPEPDAFNPCEDIMGYAFLRVLIWLINILAIFGNLTVLF VLLTSRYKLTVPRFLMCNLSFADFCMGLYLLLIASVDSQTKGQYYNHAIDWQTGSGCSAA GFFTVFASELSVYTLTVITLERWHTITYAVQLDQKLRLRHAIPIMLGGWIFSTLMATLPL VGVSSYMKVSICLPMDVESTLSQVYILSILLLNAVAFVVICACYVRIYFAVQNPELTAPN KDTKIAKKMAILIFTDFTCMAPISFFAISAAFKVPLITVTNSKVLLVLFYPVNSCANPFL YAVFTKAFQRDFFLLLSRFGCCKHRAELYRRKEFSACTFNSKNGFPRSSKPSQAALKLSI VHCQQPTPPRVLIQ
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.
Gene References into Functions
  1. Activating mutations in LHCGR cause familial male-limited precocious puberty PMID: 28339861
  2. Study tested for the first time a role of ZFP36L2 in the decay of LHR mRNA, when transcription was inhibited; results of our cell-based assay support the conclusion that LHR mRNA expression is controlled post-transcriptionally by ZFP36L2. PMID: 28455422
  3. FSHR and LHR proteins are significantly upregulated in CCs surrounding oocytes arrested at the 2-cell stage, reflecting their developmental incompetence. PMID: 24476692
  4. Triptorelin and cetrorelix induce immune responses and affect uterine development and expressions of genes and proteins of ESR1, LHR, and FSHR PMID: 27075695
  5. Data suggest that persistent cAMP signals from internalized luteinizing hormone receptor (LH receptors) contribute to transmitting LH effects inside follicle cells and ultimately to the oocyte. PMID: 26828746
  6. Demonstrate the presence of LH receptors. Activation resulted in a dose-dependent increase in glucose-induced release of insulin. PMID: 25670721
  7. LHCGR signaling in regulating the Ahr message involves protein kinase A pathway and is attributable to decreased transcription rate. PMID: 24145128
  8. Data from mutant mouse strain (gain-of-function mutation in LHR, D578G; most common mutation found in familial male-limited precocious puberty) confirm that LHR is critical for male steroidogenesis, gametogenesis, and Leydig cell development. PMID: 23861372
  9. LH/hCG tightly up-regulates MKP-3 which in turn, dephosphorylates ERK1/2 and drives p21 expression. PMID: 23261984
  10. Data suggest that Lhcgr in endometrium and luteinizing hormone in blastocyst are involved in embryo/blastocyst implantation; expression of Lhcgr is up-regulated in endometrial epithelium in estrus cycle at time of implantation readiness (estrus). PMID: 23464498
  11. Through the LHR, LH/hCG tightly regulates MKP-2 expression, which modulates the induction of CYP11A1 by 8Br-cAMP. PMID: 23471219
  12. Expression of LH receptor in nonpregnant mouse endometrium. PMID: 22875961
  13. Testicular CYP1B1 expression is regulated by LH through a PRKA-mediated pathway. PMID: 21389345
  14. Positive immunoreaction for LH receptors was present in the nuclei of urethral epithelium and endothelial cells of cavernous spaces in the corpus cavernosum and corpus spongiosum penis. PMID: 20798391
  15. Role of RXFP2 in mediating androgen-induced inguinoscrotal testis descent in LH receptor knockout mice. PMID: 20154177
  16. The study provides the first in vivo evidence linking the LH receptor, the EGFR, and ERK1/2 as sequential components of a pathway that regulates ovarian Cyp19a1 expression. PMID: 20093417
  17. Diminution of Abeta accumulation in the absence of LH receptor supports the contention that dysregulation of LH may impact the pathogenesis of Alzheimer disease. PMID: 20142765
  18. review of studies of Lhr expression and function using transgenic and knockout mouse models, including function as promoters of tumors PMID: 11988311
  19. review of knockout mice studies of the effect of inactivation of Lhr on phenotype PMID: 11988312
  20. Strain susceptibility to adrenocortical tumorigenesis (DBA/2J >> FVB/N) correlated with the expression of GATA-4 and LHR, implicating these factors in the process of adrenocortical neoplasia in response to continuous gonadotropin stimulation. PMID: 12933687
  21. Positive and reciprocal feed-forward amplification link between LHR and GATA-4 expressionleads to formation of the LH-dependent adrenocortical tumors. PMID: 15256532
  22. Lutropin and progesterone receptors exert distinct but coordinate effects on transactivation of the ADAMTS-1 gene in granulosa cells in vivo and in vitro PMID: 15256533
  23. In LH receptor knockout mice LH and CG control uterine functions directly as well as indirectly through increasing ovarian synthesis of steroid hormones. PMID: 15836959
  24. function of the extragonadal LHR using LHR-knockout mice, in which the ovaries of prepubertal mice were orthotopically replaced with pieces of wild type ovary PMID: 15951841
  25. activation of the endogenous lutropin/choriogonadotropin receptor (LHR) in mouse Leydig tumor cells leads to the tyrosine phosphorylation of the focal adhesion kinase FAK PMID: 16293639
  26. We propose that the LHR-mediated stimulation of the ERK1/2 cascade in Leydig cells depends on two independent pathways. PMID: 17727840
  27. The mRNA levels for several germ cell-specific proteins were up-regulated at 5 weeks of age in both WT and YHR(+) mice. PMID: 19013498

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family, FSH/LSH/TSH subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1