Recombinant Mouse Lysophosphatidic acid receptor 4(Lpar4)

Code CSB-CF013050MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8BLG2
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MGDRRFIDFQFQDLNSSLRPRLGNATANNTCIVDDSFKYNLNGAVYSVVFILGLITNSAS LFVFCFRMKMRSETAIFITNLALSDLLFVCTLPFKIFYNFNRHWPFGDTLCKISGTAFLT NIYGSMLFLTCISVDRFLAIVYPFRSRTIRTRRNSAIVCAGVWILVLSGGISASLFSTTN VNNATTTCFEGFSKRVWKTYLSKITIFIEVVGFIIPLILNVSCSSVVLRTLRKPATLSQI GTNKKKVLKMITVHMAVFVVCFVPYNSVLFLYALVRSQAITNCLLERFAKIMYPITLCLA TLNCCFDPFIYYFTLESFQKSFYINTHIRMESLFKTETPLTPKPSLPAIQEEVSDQTTNN GGELMLESTF
Source in vitro E.coli expression system
Gene Names Lpar4
Protein Names Recommended name: Lysophosphatidic acid receptor 4 Short name= LPA receptor 4 Short name= LPA-4 Alternative name(s): G-protein coupled receptor 23 P2Y purinoceptor 9 Short name= P2Y9 Purinergic receptor 9
Expression Region 1-370
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for lysophosphatidic acid (LPA), a mediator of diverse cellular activities. Transduces a signal by increasing the intracellular calcium ions and by stimulating adenylyl cyclase activity. The rank order of potency for agonists of this receptor is 1-oleoyl- > 1-stearoyl- > 1-palmitoyl- > 1-myristoyl- > 1-alkyl- > 1-alkenyl-LPA (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

KEGG: mmu:78134

STRING: 10090.ENSMUSP00000053986

UniGene: Mm.90147

Pathway PI3K-Akt signaling pathway
Oxidative Phosphorylation
Phospholipase D signaling pathway
Rap1 signaling pathway

Related Products

Lpar4 Proteins

Lpar4 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.