Recombinant Mouse Melanocortin receptor 3 (Mc3r)

Code CSB-CF013560MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Mc3r; Melanocortin receptor 3; MC3-R
Species
Mus musculus (Mouse)
Expression Region
1-323
Target Protein Sequence
MNSSCCLSSVSPMLPNLSEHPAAPPASNRSGSGFCEQVFIKPEVFLALGIVSLMENILVI LAVVRNGNLHSPMYFFLCSLAAADMLVSLSNSLETIMIAVINSDSLTLEDQFIQHMDNIF DSMICISLVASICNLLAIAIDRYVTIFYALRYHSIMTVRKALTLIGVIWVCCGICGVMFI IYSESKMVIVCLITMFFAMVLLMGTLYIHMFLFARLHVQRIAVLPPAGVVAPQQHSCMKG AVTITILLGVFIFCWAPFFLHLVLIITCPTNPYCICYTAHFNTYLVLIMCNSVIDPLIYA FRSLELRNTFKEILCGCNSMNLG
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for MSH (alpha, beta and gamma) and ACTH. This receptor is mediated by G proteins which activate adenylate cyclase. Required for expression of anticipatory patterns of activity and wakefulness during periods of limited nutrient availability and for the normal regulation of circadian clock activity in the brain.
Gene References into Functions
  1. MC3Rs expressed in Nkx2.1(+ve) neurons are sufficient to coordinate hypothalamic response and expression of compulsive behavioral responses involving meal anticipation and consumption of large meals during situations of prolonged negative energy balance. PMID: 28294152
  2. Replacing murine Mc3r with and double-mutant (C17A+G241A) human MC3R showed greater weight and fat mass, increased energy intake and feeding efficiency. PMID: 26818770
  3. Mc3rs are stronger modulators of food anticipatory activity compared to Ghsrs. PMID: 25211592
  4. 3' RACE experiments using hypothalamic RNA indicated the 3' UTR terminates approximately 1286 bases after the translational stop codon, with a previously unknown 787 base splice between consensus splice donor and acceptor sites. PMID: 25450386
  5. These data reveal novel protective properties of endogenous MC3 on periodontal status in health and disease PMID: 24979595
  6. Data suggest that Mc3r (not Mc4r) is expressed in 1/3 of dopaminergic neurons in ventral tegmental area (VTA); global deletion of Mc3r in knockout mice increases VTA dopamine by 42% and decreases sucrose intake/preference in female (not male) mice. PMID: 24605830
  7. The melanocortin-3 receptors are involved in regulating adaptation to food restriction. PMID: 22353545
  8. impact of central MC3Rs on behavior and metabolism PMID: 21984834
  9. Mutually opposite signal modulation by hypothalamic heterodimerization of ghrelin and melanocortin-3 receptors. PMID: 21940628
  10. data suggest that the melanocortin-3 receptor is involved in the control of energy balance and the expression of rhythms anticipating nutrient intake. PMID: 21497617
  11. MC(3) plays a subtle role in the regulation of food intake PMID: 21199647
  12. Compared with WT, MC4R-/- showed no activation in area postrema but showed normal activation in paraventricular hypothalamus, whereas MC3R-/- showed reduced activation in PVN but not in AP. PMID: 20800636
  13. Findings identify MC(3)-mediated signaling as a beneficial pathway in experimental arthritis. PMID: 20702773
  14. Central nervous system melanocortin-3 receptors are required for synchronizing metabolism during entrainment to restricted feeding during the light cycle. PMID: 19837866
  15. Neural Mc3rs are important for adapting metabolism and maintaining rhythms of liver metabolism during periods when feeding is restricted to the light cycle PMID: 19837866
  16. Results demonstrate that peripherally administered melanocortin receptor 3/4 agonists regulate body weight, liver metabolism and glucose homeostasis through independent pathways. PMID: 19646498
  17. Agonism at MC3-R expressed on peritoneal macrophages leads to inhibition of experimental nonimmune peritonitis in both wild-type and recessive yellow (e/e) Mc1r-deficient mice. PMID: 12626592
  18. Results suggest that the melanocortin 4 receptor (MC4R), but not the MC3R, is required for the stimulation of energy expenditure in response to melanocortin agonists and voluntary hyperphagia. PMID: 12851322
  19. A predominant role is indicated for MC3-R in the induction of heme oxygenase-1 expression and activity in macrophages that may be of functional relevance in determining MC-R-dependent control of the host inflammatory response. PMID: 15699165
  20. Deletion results in a decreased sensitivity to ghrelin and verifies the involvement in the melanocortin system in ghrelin-induced food intake. PMID: 16005545
  21. MC3 receptor is the major player in mediating the anti-inflammatory activity of melanocortins in the central nervous system PMID: 16414147
  22. diet-induced obesity affects insulin sensitivity more severely in Mc4rKO compared with Mc3rKO, perhaps due to a more positive energy balance PMID: 16469808
  23. The actions of intracerebroventricular alpha-MSH appear to be mediated via Mc4r, whereas those of gamma-MSH are independent of its receptor Mc3r, but reflect the activation of a sodium channel in the central nervous system PMID: 17053546
  24. Using a transgenic and pharmacological approach, we provide strong proof of concept for the development of selective MC3-R agonists as novel anti-inflammatory therapeutics. PMID: 17077300
  25. analysis of activation and endocytic internalization of melanocortin 3 receptor in neuronal cells PMID: 17405938
  26. Results show that despite large increases in body fat, melanocortin 3-receptor (MC3-R)-deficient mice do not get fatty liver disease or severe insulin resistance. PMID: 17901224
  27. Maintenance of normal serum adiponectin may be a factor in the relatively mild insulin-resistant phenotype of severely obese Mc3rKO mice. PMID: 18070757
  28. data reveal the existence of a tonic inhibitory signal provided by MC3R in the mesenteric microcirculation of the mouse, acting to down-regulate cell trafficking and local mediator generation. PMID: 18757499
  29. In summary, Mc3r are required for expression of anticipatory patterns of activity and wakefulness during periods of limited nutrient availability and for normal regulation of cortical clock function. PMID: 19036988
  30. Results describe the effects of dopamine D2 receptor deletion on hypothalamic expression of orexin, orexin receptor 1, alphaMSH, NPY and melanocortin receptors 3 and 4. PMID: 19570576
  31. Mc3r are required for expression of anticipatory patterns of activity and wakefulness during periods of limited nutrient availability and for normal regulation of cortical clock function PMID: 19036988

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Brain.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1