Recombinant Mouse Melanocortin receptor 4 (Mc4r)

Code CSB-CF013561MO
MSDS
Size $1620
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Mc4r
Uniprot No.
Research Area
Cardiovascular
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-332aa
Target Protein Sequence
MNSTHHHGMYTSLHLWNRSSYGLHGNASESLGKGHPDGGCYEQLFVSPEVFVTLGVISLLENILVIVAIAKNKNLHSPMYFFICSLAVADMLVSVSNGSETIVITLLNSTDTDAQSFTVNIDNVIDSVICSSLLASICSLLSIAVDRYFTIFYALQYHNIMTVRRVGIIISCIWAACTVSGVLFIIYSDSSAVIICLISMFFTMLVLMASLYVHMFLMARLHIKRIAVLPGTGTIRQGTNMKGAITLTILIGVFVVCWAPFFLHLLFYISCPQNPYCVCFMSHFNLYLILIMCNAVIDPLIYALRSQELRKTFKEIICFYPLGGICELSSRY
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
43.0 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor specific to the heptapeptide core common to adrenocorticotropic hormone and alpha-, beta-, and gamma-MSH. Plays a central role in energy homeostasis and somatic growth. This receptor is mediated by G proteins that stimulate adenylate cyclase (cAMP).
Gene References into Functions
  1. Mc4r knockout offspring showed higher body, liver and adipose tissue weights; and mild hepatic steatosis PMID: 28930194
  2. vertebrate limb regeneration with Mc4r-mediated energy homeostasis and provide a new avenue for understanding Mc4r signaling in the peripheral organs PMID: 30130530
  3. Together this study identifies MC4R deletion as a novel and potentially clinically important cause of dilated cardiomyopathy and heart failure. PMID: 28829041
  4. Data suggest that central melanocortin-4 receptor (MC4-R) and tryptophan hydroxylase (TPH) are involved in the efferent neuronal control of the kidneys. PMID: 27626491
  5. Data (including data from studies in knockout mice) suggest that expression of Mc4r in Sim1 neurons of arcuate nucleus of hypothalamus, paraventricular hypothalamic nucleus, and amygdala is involved in sexual function; here, expression of Mc4r only on Sim1 neurons reverses sexual deficits seen in Mc4r null mice. (Mc4r = melanocortin 4 receptor; Sim1 = single-minded homolog 1) PMID: 29059347
  6. disruption of this hippocampal POMC/MC4R circuit might contribute to synaptic dysfunction observed in Alzheimer's disease. PMID: 27829153
  7. Study shows that melanocortin 4 receptor constitutive activity chronically inhibits specific subtypes of neuronal voltage-gated calcium channels. PMID: 28093215
  8. Loss of MC4R is associated with hepatic steatosis. PMID: 28003536
  9. The data suggest that lipid stress disrupts steps of endocytosis following MC4R localization to clathrin-coated sites and exclusion of the receptor from the extracellular medium. PMID: 28878020
  10. Confirmation of the impairment of GH-IGF-1 release in hyperphagic MC4R KO mice suggests a role for insulin in regulating both the release of GH, but also in mediating growth during periods of physiologically suppressed GH-IGF-1 levels PMID: 27558671
  11. Loss of Mc4r expression is associated with non-alcoholic fatty liver disease. PMID: 28207798
  12. results indicate that the MC4R is not required for estrogen's effects on metabolic and reproductive functions PMID: 28403939
  13. Mc4r receptor expression in the cuneiform nucleus is involved in modulation of opioidergic signaling. PMID: 26489618
  14. Together, these results suggest that alpha-MSH alleviates Dex-induced damages to cultured osteoblasts through activating MC4R-SphK1 signaling. PMID: 26631960
  15. Our findings support the hypothesis that MC4R signaling in the pedunculopontine tegmental nucleus may involve in the modulation of midbrain dopamine systems. PMID: 25973101
  16. These results indicate that intact CNS MC4R signaling is necessary for leptin to exert its chronic antidiabetic, anorexic, and cardiovascular actions. PMID: 25717164
  17. Mc4r signaling has a protective role in minimizing glucose fluctuations due to circadian rhythms and environmental light cues, a previously undiscovered connection between circadian biology and glucose metabolism mediated through the melanocortin system. PMID: 25730108
  18. MC4R specifically inhibited the presynaptic N-type channel subtype, and this inhibition may be important for the effects of melanocortin in the central subdivision of the amygdala PMID: 24943127
  19. Coupling of MC4R to Kir7.1 may explain unusual aspects of the control of energy homeostasis by melanocortin signalling, including the gene dosage effect of MC4R and the sustained effects of AgRP on food intake. PMID: 25600267
  20. The MC4R-expressing neurons regulating feeding are SIM1(+), located in the paraventricular hypothalamus, glutamatergic and not GABAergic, and do not express oxytocin, corticotropin-releasing hormone, vasopressin, or prodynorphin. PMID: 25157144
  21. These findings highlight an essential, and to our knowledge previously unknown, role for Ca(2+) signaling in the MC4R pathway that leads to satiety, and a novel non-redundant role for NCKX4-mediated Ca(2+) extrusion in controlling MC4R signaling PMID: 25096581
  22. Posttranscriptional decrease of MC4R protein lowers the response to alpha-MSH in hypothalamic neurons exposed to even a mild level of lipid stress. PMID: 24506538
  23. MC4R signaling in motor cortex- periaqueductal gray-spinal cord neural pathway may modulate the activity of sympathetic outflow sensitive to nociceptive signals. PMID: 24586817
  24. Our findings support the hypothesis that MC4R signaling in RVM may modulate the activity of serotonergic sympathetic outflow sensitive to nociceptive signals, and that MC4R signaling in RVM may contribute to the descending modulation of nociception. PMID: 23592129
  25. Deletion of Mc4r genes in both sympathetic and parasympathetic cholinergic neurons impaired glucose homeostasis PMID: 24908101
  26. MC4R-expressing dorsal motor nucleus neurons may participate in the regulation of glucose/insulin homeostasis through their projections to the intrapancreatic ganglia PMID: 24028856
  27. MC4R signaling in D1R neurons regulates food intake and development of locomotor sensitization to cocaine. PMID: 23786641
  28. Exposure of MC4R to agonist in the endoplasmic reticulum stabilizes an active conformation of the receptor that does not desensitize. PMID: 24248383
  29. The results of this study provided evidence the role of MC4-R expressed by neurons innervating the PVH that are also sensitive to reproductive cues. -------------------------------------------------------------------------------- PMID: 23485805
  30. MC4Rs in Pomc neurons are important for regulation of energy balance but do not have major role in regulation cardiovascular functions. PMID: 23842677
  31. our novel findings show that activation of MC4-Rs in the brainstem modulates gastric activity, which may have physiological relevance for food intake and gastric function PMID: 23946387
  32. Both constitutive and induced genetic deletion of the melanocortin 4 receptor (MC4R) gene normalizes compulsive grooming and striatal electrophysiologic impairments in SAPAP3-null mice PMID: 23754400
  33. MC4Rs in autonomic neurons mediate beneficial effects of roux-en-Y gastric bypass, including weight-independent improved glucose homeostasis, in mice and humans. PMID: 23159449
  34. our findings demonstrate variegated MC4R expression in different classes of vagal and spinal primary afferent neurons PMID: 22592759
  35. Deletion of MC4Rs in cholinergic neurons resulted in elevated levels of insulin. Furthermore, re-expression of MC4Rs specifically in cholinergic neurons (including sympathetic preganglionic neurons) restores obesity-associated hypertension in MC4R null mice. PMID: 23374353
  36. MC4R in the hippocampus plays a critical role in the regulation of structural and functional plasticity PMID: 23303927
  37. MC4RKO mice display increased lean body mas PMID: 22848742
  38. heparanase acts as a negative modulator of AgRP signaling at MC4R, through cleavage of heparan sulfate chains presumably linked to syndecan-3 PMID: 22479599
  39. MC4R(-/-) mice lost substantially less weight after surgery than wild-type animals, indicating that MC4R signaling is necessary for the weight loss effects of gastric bypass in this model. PMID: 22492873
  40. chronic stress in mice decreases the strength of excitatory synapses on D1 dopamine receptor-expressing nucleus accumbens medium spiny neurons owing to activation of the melanocortin 4 receptor PMID: 22785313
  41. data identify a novel requirement for MC4R signaling in procedural memory learning. PMID: 22342812
  42. MC4R and NPY are required for activation of hepatic pathways that metabolize T(4) during the fasting response. PMID: 22100407
  43. Melanocortin 4 receptor is a transcriptional target of nescient helix-loop-helix-2 PMID: 21664420
  44. the md and mg mutations rescue the A(y) phenotypes by a primarily cAMP-independent mechanism promoting trafficking of MC4R and likely MC1R away from the lysosome toward the cell surface. PMID: 21460229
  45. Analysis of the microstructure of feeding behavior in response to dietary fat in the MC4R(-/-) and MC4R(+/-) mice indicates that the high-fat hyperphagia involves defective satiation and an increased rate of food intake. PMID: 21239438
  46. A long-term high-fat diet may have an effect on the methylation status of the Mc4r gene in mice. PMID: 20453306
  47. T(3) repression of Mc4r transcription ensures that the energy-saving effects of T(3) feedback on Trh are not overridden by MC4R activation of Trh PMID: 20160073
  48. Data suggest that MC4R signaling in vagal afferents may modulate the activity of fibers sensitive to satiety signals such as cholecystokinin, and that MC4R signaling in vagal efferents may contribute to the control of the liver and gastrointestinal tract. PMID: 19882715
  49. has a role in sexual function in mice PMID: 12172010
  50. MC4R deficiency primarily causes hyperphagia without hypometabolism: total body fat content of MC4r-/- animals on day 35 and MC4r+/- on day 56 significantly exceeds that of MC4r+/+ mice. PMID: 12644632

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*