Recombinant Mouse Mucolipin-1(Mcoln1)

Code CSB-CF859533MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q99J21
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MATPAGRRASETERLLTPNPGYGTQVGTSPAPTTPTEEEDLRRRLKYFFMSPCDKFRAKG RKPCKLMLQVVKILVVTVQLILFGLSNQLVVTFREENTIAFRHLFLLGYSDGSDDTFAAY TQEQLYQAIFYAVDQYLILPEISLGRYAYVRGGGGPWANGSALALCQRYYHRGHVDPAND TFDIDPRVVTDCIQVDPPDRPPDIPSEDLDFLDGSASYKNLTLKFHKLINVTIHFQLKTI NLQSLINNEIPDCYTFSILITFDNKAHSGRIPIRLETKTHIQECKHPSVSRHGDNSFRLL FDVVVILTCSLSFLLCARSLLRGFLLQNEFVVFMWRRRGREISLWERLEFVNGWYILLVT SDVLTISGTVMKIGIEAKNLASYDVCSILLGTSTLLVWVGVIRYLTFFHKYNILIATLRV ALPSVMRFCCCVAVIYLGYCFCGWIVLGPYHVKFRSLSMVSECLFSLINGDDMFVTFAAM QAQQGHSSLVWLFSQLYLYSFISLFIYMVLSLFIALITGAYDTIKHPGGTGTEKSELQAY IEQCQDSPTSGKFRRGSGSACSLFCCCGRDSPEDHSLLVN
Source in vitro E.coli expression system
Gene Names Mcoln1
Protein Names Recommended name: Mucolipin-1 Alternative name(s): Mucolipidin
Expression Region 1-580
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Nonselective cation channel probably playing a role in the regulation of membrane trafficking events and of metal homeostasis
Subcellular Location Late endosome membrane, Multi-pass membrane protein, Lysosome membrane, Multi-pass membrane protein, Cytoplasmic vesicle membrane, Multi-pass membrane protein, Cell projection, phagocytic cup, Cytoplasmic vesicle, phagosome membrane, Multi-pass membrane protein, Cell membrane, Multi-pass membrane protein
Protein Families Transient receptor (TC 1.A.4) family, Polycystin subfamily, MCOLN1 sub-subfamily
Tissue Specificity Widely expressed, with the highest expression in brain, liver and kidney.
Database Links

KEGG: mmu:94178

STRING: 10090.ENSMUSP00000004683

UniGene: Mm.8356

Related Products

Mcoln1 Proteins

Mcoln1 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.