Recombinant Mouse Muscarinic acetylcholine receptor M3 (Chrm3)

Code CSB-CF872136MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Chrm3; Chrm-3; Muscarinic acetylcholine receptor M3; Mm3 mAChR
Species
Mus musculus (Mouse)
Expression Region
1-589
Target Protein Sequence
MTLHSNSTTSPLFPNISSSWVHSPSEAGLPLGTVSQLDSYNISQTSGNFSSNDTSSDPLG GHTIWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVIS MNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRT TKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFY MPVTIMTILYWRIYKETEKRTKELAGLQASGTEAEAENFVHPTGSSRSCSSYELQQQGTK RSSRRKYGGCHFWFTTKSWKPSAEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSET RAIYSIVLKLPGHSTILNSTKLPSSDNLQVPDKDLGTMDVERNAHKLQAQKSMDDRDNCQ KDFSKLPIQLESAVDTAKTSDTNSSVDKTTAALPLSFKEATLAKRFALKTRSQITKRKRM SLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVNP VCYALCNKTFRTTFKMLLLCQCDKRKRRKQQYQQRQSVIFHKRVPEQAL
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover.
Gene References into Functions
  1. The expression of M3-mAChR was down-regulated in the myocardium from aged mice and D-galactose-treated mice, while the expression levels of caspase-1 and its downstream molecule IL-1beta were significantly increased. PMID: 30196290
  2. Stimulation of the ERK pathway in Gnb5(-/-) cells by epidermal growth factor restored M3R-stimulated insulin release to near normal levels. Identification of the novel role of Gbeta5-R7 in insulin secretion may lead to a new therapeutic approach for improving pancreatic beta-cell function PMID: 28687610
  3. s. Moreover, we found that M3 cholinergic receptor (CHRM3) was upregulated in a large subset of benign prostatic hyperplasia (BPH) tissues compared with normal tissues. Activation of CHRM3 also promoted the proliferation of BPH cells. PMID: 27167157
  4. early intervention with cholinergic receptor muscarinic (ChRM)-3 blocker reversed the progression of airway hyperreactivity in the neonatal exposure model, whereas beta2-adrenoceptor agonists had no such effect PMID: 28619712
  5. We found that knockout of the M2/3 receptor significantly inhibited ST37 acupuncture-induced enhancement of gastric motility, jejunal motility, and colonic motility. PMID: 27978539
  6. Type 3 muscarinic receptors contribute to intestinal mucosal homeostasis and clearance of Nippostrongylus brasiliensis through induction of TH2 cytokines. PMID: 27173511
  7. Arthritis-induced joint destruction was significantly stronger in mice with M3 muscarinic acetylcholine receptor deficiency. PMID: 26785775
  8. The effects of muscarinic receptor M3 knockout on cathepsin K expression, bone density and biomechanical properties of bone are reported. PMID: 26002583
  9. results suggest that the autoantibodies against peptides of the second extracellular loop of M3R are not pathogenic in vivo and they are not suitable as biomarkers for pSS diagnosis PMID: 26901532
  10. Expression of the M3 receptors mediating cholinergic contractile stimuli of the detrusor muscle was dysregulated in both Mras-/- males and females, although only males exhibited a urinary phenotype. PMID: 26516777
  11. The study screened CrkL binding proteins using RNA interference (RNAi) and identified Sorbs1 and Sorbs2 as two proteins that are enriched at AChR clusters and are required for the formation of AChR aggregation in vitro. PMID: 26527617
  12. Activation of Chrm3 inhibits the recruitment of beta-arrestin-2 to odorant receptors, resulting in a potentiation of odor-induced responses in olfactory sensory neurons. PMID: 25800153
  13. The muscarinic M3R receptor interacts directly with NOSTRIN at the plasma membrane in the aorta. PMID: 26169369
  14. Cholinergic signalling via the M3R is essential for optimal Th1 and Th2 adaptive immunity to infection. PMID: 25629518
  15. These findings indicate that the M(3) receptor on structural cells plays a proinflammatory role in CS-induced neutrophilic inflammation, whereas the M(3) receptor on inflammatory cells does not. PMID: 25381025
  16. Our results identify a novel candidate mouse gene, Zfp277, whose expression pattern is compatible with a role in mediating divergent effects of Chrm3 and Chrm1 gene ablation on murine intestinal neoplasia. PMID: 24694019
  17. M3 acetylcholine receptors are increased in beta cells as a mechanism to compensate for amino acid deficiency PMID: 24695728
  18. In this review, genetic modifications of muscarinic M3 receptor cause robust alterations in insulin levels and glucose tolerance. PMID: 24114586
  19. The upregulation of M-mAChR during myocardial hypertrophy could relieve the hypertrophic response provoked by angiotensin II. PMID: 24028210
  20. Data indicate that acetylcholine contributes to allergen-induced remodeling and smooth muscle mass via the muscarinic M3 receptor. PMID: 24156289
  21. Activation of alpha2A-AR and muscarinic M3 receptors affects the initial [Ca(2+)] response to increase of glucose from 3 to 20mM in BETA-cells. PMID: 24565843
  22. M2 receptors play an essential role in the generation of intestinal rhythmic motor activity, and M3 receptors have a modulatory role in controlling the periodicity of the rhythmic activity PMID: 23889852
  23. These results suggest that mAChRs in mouse colonic epithelial cells consist of two subtypes, M1 (80 %) and M3 (20 %). PMID: 23242454
  24. M3 receptor and VGLUT2 are co-localized on intraganglionic laminar endings of esophagus. PMID: 23742744
  25. in murine ophthalmic arteries the muscarinic M3 receptor subtype mediates cholinergic endothelium-dependent vasodilation and endothelium-independent vasoconstriction. PMID: 24408978
  26. Oscillatory Ca2+ increase in response to M3 muscarinic acetylcholine receptor stimulation is dependent upon a moderate IP3 increase, which is suitable for causing Ca(2+)-dependent IP3-induced Ca2+ release. PMID: 23747049
  27. the restricted M3 muscarinic receptors expression contributes to the propagation Ca2+ signaling triggered by Acetylcholine. PMID: 23407022
  28. Immunization of muscarinic acetylcholine 3 receptor induces the secretion of IL-17 and IFN-gamma in NOD-scid mice. PMID: 23232510
  29. Blockage of mAChR exerts anti-inflammatory properties, and M3R plays an important role in the LPS-induced lung inflammation PMID: 22910223
  30. Data suggest that although M3R is located on both myocardial cells and endocardial endothelial cells, only endothelial M3R mediates positive inotropy in response to muscarinic agonists via activation of cyclooxygenase 2 in the atrium. PMID: 22726658
  31. These results indicate that alpha7-nAChR are not involved in the regulation of bone collagen synthesis whereas M3R exert stimulatory effects on cancellous bone microarchitecture, flexural rigidity, and bone matrix synthesis. PMID: 22871384
  32. Studies with M3R mutant mice strongly suggest that strategies aimed at enhancing signaling through beta-cell M3R receptor may be useful in the treatment of type 2 diabetes by promoting insulin release and improving beta-cell function in general.[review] PMID: 22525375
  33. Findings support the concept that the inhibitory effects of SPL on M3R activity are mediated by RGS4. PMID: 22730439
  34. M-mAChR overexpression dramatically reduced the incidence of arrhythmias and decreased the mortality in a mouse model of myocardial ischemia-reperfusion (I/R). PMID: 21785809
  35. interplay of Chrm3 and beta-catenin signaling is important for intestinal mucosal differentiation and neoplasia. PMID: 21705482
  36. Caveolae disruption decreased muscarine-induced bronchoconstriction in wild-type and abolished it in M2R(-/-) and M3R(-/-) mice. Thus M2R and M3R signaling pathways require intact caveolae. PMID: 20023174
  37. M receptors mediate cholinergic vasodilation in cutaneous, skeletal muscle, and renal interlobar arteries. PMID: 21335473
  38. The expression of M3R in different cell types during skin wound healing is time-dependent. PMID: 20707271
  39. M(3)-muscarinic receptor-mediated augmentation of sustained insulin release is largely independent of G protein-coupling but involves phosphorylation-/arrestin-dependent coupling of the receptor to protein kinase D1 PMID: 21078968
  40. Results suggest acetylcholine-M3 muscarinic receptor may be involved in itching associated with some chronic pruritus diseases such as atopic dermatitis. PMID: 20595784
  41. NF-kappaB signalling plays an essential role in controlling the expression of the muscarinic M(3) receptor. PMID: 20541544
  42. determination of m2 and m3 muscarinic receptors in the central auditory system PMID: 20665816
  43. Signaling through the M(3) muscarinic receptor favors bone mass accrual by decreasing sympathetic activity. PMID: 20197056
  44. The M3-muscarinic receptor regulates learning and memory in a receptor phosphorylation/arrestin-dependent manner. PMID: 20439723
  45. Chrm3 plays a critical role in the liver injury response by modulating hepatocyte proliferation and apoptosis PMID: 20197374
  46. M3 mAChRs in distinguish parvalbumin-positive from cholecystokinin-positive basket cells; findings demonstrate that cell type-specific cholinergic specializations are present on neurochemically distinct interneuron subtypes in the hippocampus PMID: 20427660
  47. RGS2 is an important cholinergic regulator in the atrium. RGS2(-/-) mice have enhanced susceptibility to atrial fibrillation via enhanced M3 muscarinic receptor activity. PMID: 19966055
  48. The role of M3 muscarinic receptor in smooth muscle contraction is analyzed in M3 knockout mice. PMID: 12486155
  49. When the muscarinic M3 receptor is deleted, cholinergic-induced relaxation is unmasked in the stomach fundus. PMID: 12538821
  50. The M3 mAChRs are involved in exocrine gland secretion, smooth muscle contractility, pupil dilation, food intake, and weight gain. Review. PMID: 12675128

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family, Muscarinic acetylcholine receptor subfamily, CHRM3 sub-subfamily
Tissue Specificity
Expressed in cerebral cortex, submandibular gland, hypothalamus, pancreas, liver, and ileum.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1