Recombinant Mouse Muscarinic acetylcholine receptor M4 (Chrm4)

Code CSB-CF005384MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Chrm4; Chrm-4; Muscarinic acetylcholine receptor M4; Mm4 mAChR
Species
Mus musculus (Mouse)
Expression Region
1-479
Target Protein Sequence
MANFTPVNGSSANQSVRLVTTAHNHLETVEMVFIATVTGSLSLVTVVGNILVMLSIKVNR QLQTVNNYFLFSLACADLIIGAFSMNLYTLYIIKGYWPLGAVVCDLWLALDYVVSNASVM NLLIISFDRYFCVTKPLTYPARRTTKMAGLMIAAAWVLSFVLWAPAILFWQFVVGKRTVP DNQCFIQFLSNPAVTFGTAIAAFYLPVVIMTVLYIHISLASRSRVHKHRPEGPKEKKAKT LAFLKSPLMKPSIKKPPPGGASREELRNGKLEEAPPPALPPPPRPVADKDTSNESSSGSA TQNTKERPPTELSTTEAATTPALPAPTLQPRTLNPASKWSKIQIVTKQTGSECVTAIEIV PATPAGMRPAANVARKFASIARNQVRKKRQMAARERKVTRTIFAILLAFILTWTPYNVMV LVNTFCQSCIPERVWSIGYWLCYVNSTINPACYALCNATFKKTFRHLLLCQYRNIGTAR
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is inhibition of adenylate cyclase.
Gene References into Functions
  1. The findings of this study indicated that the cocaine-like S(D) effects of muscarinic antagonists are primarily mediated through M1 receptors, with a minor contribution of M4 receptors. PMID: 28442355
  2. In the present study, the functional coupling of Gi/o protein-coupled receptors to GalR1, and the CB1 receptor subtype for endocannabinoids were analyzed in the 3xTg-AD mice model of Alzheimer's disease in the prodromal and advanced stages. In addition, the activity mediated by Gi/o protein-coupled M2/4 muscarinic receptor subtypes was also analyzed in brain areas involved in anxiety and cognition. PMID: 27223629
  3. Muscarinic acetylcholine receptor subtype 4 is essential for cholinergic stimulation of duodenal bicarbonate secretion in mice - relationship to D cell/somatostatin PMID: 26084221
  4. Allosteric activation of M4 muscarinic receptors improve behavioral and physiological alterations in early symptomatic Huntington's disease - YAC128 mice. PMID: 26508634
  5. the role of the M4 receptor in alcohol consumption PMID: 25445043
  6. We show that M4 is a major mAChR subtype mediating the cholinergic inhibition of corticostriatal glutamatergic input on both striatonigral and striatopallidal medium spiny neurons (MSNs). PMID: 24528004
  7. The characterization of the orthosteric agonist, iperoxo, at the M(4) receptor. PMID: 24807965
  8. These data support a role for the M4AChR subtype in mediating the antipsychotic-like activity of BuTAC. PMID: 23907402
  9. Presence of M4 mAChR is sufficient and necessary to mediate the carbachol-induced membrane hyperpolarization and inhibition of SpECTs in laterodorsal tegmental nucleus neurons. PMID: 22956788
  10. M4R is involved in regulation of locomotor activity, social behavior, and sensorimotor gating in mice. PMID: 22463818
  11. Reducing M4 receptor signaling altered only select behavioral phenotypes in the Fmr1KO mouse model, suggesting that other targets are involved in the modulation of fragile X behaviors. PMID: 22123412
  12. Chrm4 receptor is located on presynaptic glutamatergic terminals afferent to the recorded pyramidal neuron, thus decreasing glutamate release. PMID: 20600670
  13. The muscarinic M(4) receptor is the functionally predominant subtype in mouse striatum. PMID: 21114972
  14. Different coupling of striatal M(2)/M(4)-mAChRs to the control of DA release in CPu versus NAc suggests targets to influence DA/ACh function differentially between striatal domains. PMID: 20203199
  15. a distinct subpopulation of neuronal M(4) mAChRs plays a critical role in modulating several important dopamine-dependent behaviors. PMID: 20147565
  16. muscarinic analgesia is exclusively mediated by a combination of M(2) and M(4) mAChRs at both spinal and supraspinal sites. PMID: 12391271
  17. M(4) mAChR plays a central role in mediating cholinergic control of keratinocyte migration by endogenous acetylcholine produced by these cells PMID: 12628458
  18. M4 mAChRs modulate dopamine activity in motor tracts and act as inhibitory autoreceptors in striatum. Review. PMID: 12675128
  19. There is a crucial role for M4 receptors in the tonic and phasic regulation of acetylcholine efflux in the hippocampus as well as in cognitive processes. The M4 receptor participates in a tonic regulatory loop contolling basal acetylcholine levels. PMID: 12874603
  20. loss of M4 muscarinic receptor control of cholinergic function effectuates a state of dopaminergic hyperexcitability PMID: 15231726
  21. M4 increases expression of "migratory" integrins; M4 effects resulted from inhibition of the inhibitory pathway involving the adenylyl cyclase-cyclic AMP-protein kinase A pathway PMID: 15263021
  22. This study indicate that both M4 mediate the muscarinic autoinhibition in ACh release in the longitudinal muscle with myenteric plexus preparation of the mouse ileum. PMID: 15574798
  23. M2 and M5 muscarinic receptors but not M4 muscarinic receptor or D2 dopamine receptors are needed for male USV production during male-female interactions PMID: 18382674
  24. Results suggest that GRK5 deficiency leads to a reduced hippocampal ACh release and cholinergic hypofunction by selective impairment of desensitization of presynaptic M2/M4 autoreceptors. PMID: 19478075

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family, Muscarinic acetylcholine receptor subfamily, CHRM4 sub-subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1