Recombinant Mouse Neuropeptide Y receptor type 1 (Npy1r)

Code CSB-CF016035MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Npy1r; Neuropeptide Y receptor type 1; NPY1-R
Species
Mus musculus (Mouse)
Expression Region
1-382
Target Protein Sequence
MNSTLFSKVENHSIHYNASENSPLLAFENDDCHLPLAVIFTLALAYGAVIILGVSGNLAL IIIILKQKEMRNVTNILIVNLSFSDLLVAVMCLPFTFVYTLMDHWVFGETMCKLNPFVQC VSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYIGITVIWVLAVASSLPFVIYQILTD EPFQNVSLAAFKDKYVCFDKFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRR NNMMDKIRDSKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLL FLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSK TSLKQASPVAFKKISMNDNEKV
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for neuropeptide Y and peptide YY.
Gene References into Functions
  1. This study showed that the Npy1r(Y5R-/-) male mice display decreased 5-hydroxytriptamine (5-HT) positive fibres and increased baseline neural activity in orbitofrontal cortex. PMID: 29353053
  2. the lack of Y1Rs stimulates the formation of larger multinucleated osteoclasts in vitro with reduced bone-resorbing activity. PMID: 27646989
  3. Knockdown of the Y1 receptor induces alkaline phosphatase activity and mineralization of MC3T3-E1 cells. PMID: 28656295
  4. The vasoconstrictive mechanism has been identified as neuropeptide Y acting on Y1 receptors. PMID: 27244241
  5. findings suggest that reduced Y1R expression leads to a decrease in resting vagal modulation and heart rate variability, which, in turn, may determine a reduced cardiac autonomic responsiveness to acute stress challenges. PMID: 27474416
  6. conditional inactivation of Y1 receptors specifically in Y5 receptor containing neurons increases stress-related anxiety without affecting endocrine stress responses. PMID: 26178014
  7. Npy1r(Y5R-/-) mice show increased anxiety-related behavior but no changes in hypothalamus-pituitary-adrenocortical axis activity or in body weight growth, independently of gender and mouse strain used as foster mothers. Also, Npy1r(Y5R-/-) mice of both genders display increased spatial reference memory in the Morris water maze test. PMID: 24548641
  8. Study shows pronounced adaptive changes in the mouse hippocampus both with regard to NPY synthesis and NPY receptor synthesis and binding, which may contribute to regulating neuronal seizure susceptibility after kainate PMID: 24985894
  9. NPY and its Y receptor are possible mediators of both vasoconstriction and pulmonary vascular remodelling in pulmonary hypertension PMID: 24779394
  10. an integrated neural circuit modulates growth hormone release relative to food intake; data provide essential information to address the differential roles of Y1 and Y2 receptors in regulating the release of GH under fed and fasting states PMID: 25471570
  11. Regulation of neuropeptide Y Y1 receptor expression by bone morphogenetic protein 2 in C2C12 myoblasts PMID: 24025680
  12. These findings suggest that the global absence of the Y1 receptor delays fracture healing, through impairing the early phases of fracture repair to achieve bony union. PMID: 23733357
  13. Neuropeptide Y1 receptor in immune cells regulates inflammation and insulin resistance associated with diet-induced obesity. PMID: 23011592
  14. These studies demonstrate the pivotal, combined role of both Y1 and Y5 receptors in the mediation of food intake. PMID: 22768253
  15. Data from knockout (KO) mice suggest roles for neuropeptide Y (Npy) and Npy1 receptors in extinction of conditioned fear. Npy1r/Npy2r double KO mice display excessive recall of conditioned fear/impaired fear extinction. PMID: 22289084
  16. NPY Y1 receptor deficient mice lack the expression of appetitive behavior. PMID: 21923762
  17. study demonstrates that signalling through Y1-receptors emerges as a critical pathway for the development of airway inflammation PMID: 21383768
  18. In dentate gyrus proliferative effect of neuropeptide Y is mediated by the Y1 and not the Y2 receptor, as a Y1 ([Leu31,Pro34]), but not a Y2 (NPY3-36), receptor agonist enhanced neurogenesis. PMID: 20095007
  19. Fluctuations in circulating levels of gonadal hormones, depending on estrous cycle, are paralleled by changes in the expression of NPY Y1 receptor in the hypothalamic nuclei involved in the control of both energy balance and reproduction. PMID: 21514339
  20. Data show that Y2R is mostly presynaptic, coexists with NPY and NPY Y1R, and suggest that Y2Rs thus have a modulatory role in mediating presynaptic neurotransmitter release. PMID: 21452195
  21. These data demonstrate a direct role for the Y1 receptor on osteoblasts in the regulation of osteoblast activity and bone formation. PMID: 21040809
  22. findings attest to a role of Y1 receptor signalling in the control of stress coping and/or adaptation PMID: 19351805
  23. The NPY system, via the Y1 receptor, directly inhibits the differentiation of mesenchymal progenitor cells as well as the activity of mature osteoblasts. PMID: 20200977
  24. These data indicate that ATP initiates neuroproliferation via NPY upregulation, NPY release, and Y1 receptor activation, and suggests that the olfactory epithelium is good model to study neuroregenerative mechanisms in the CNS. PMID: 20211262
  25. The Y(1) receptor influences the acoustic startle response and its habituation but does not play a major role in sensorimotor gating. PMID: 20096928
  26. The NPY Y1 receptor regulates voluntary ethanol consumption and some of the intoxicating effects caused by administration of ethanol PMID: 11826154
  27. Expression of neuropeptide Y Y1 receptor gene is altered in medial amygdala of transgenic mice during pregnancy and after delivery PMID: 12358774
  28. Reduction of NPY1 receptor gene expression in ventromedial nucleus. Significant increase in Y1R/LacZ transgene expression and NPY1 receptor mRNA were observed in arcuate nucleus of mice on 18th day of pregnancy. PMID: 12960052
  29. biological redundancies between Y1 and Y5 receptor signaling in the NPY-mediated control of food intake. PMID: 14525913
  30. The neuropeptide Y Y1 receptor mediates NPY-induced inhibition of the gonadotrope axis under food restriction conditions. PMID: 14597564
  31. These results suggest that neuropeptide Y acting through Y1 receptors regulates the serotonin system, thereby coordinately linking physiological survival mechanisms such as food intake with enabling territorial aggressive behavior. PMID: 15314215
  32. NPY Y1 KOs showed: reduced somatomotor activation ,lower heart rate,larger heart rate responsiveness during social defeat, increased number of alpha2-ARs in the dorsal motor nucleus of the vagus (nX) and the locus coeruleus (LC). PMID: 15652259
  33. Y1-R-specific hybridization was observed within the mouse hypothalamus. Y1-R mRNA expression was observed in MC4-R-positive cells in several brain sites such as the PVH and central nucleus of the amygdala. PMID: 15690487
  34. Compensatory changes in the expression of Y2-receptors occur in Y1-receptor-deficient mice. These adaptations are likely to contribute to changed physiological function. PMID: 16198492
  35. The important role of Y(1) receptors is the regulation of motor activity, exploration, and anxiety-related behaviours. PMID: 16203045
  36. The effects of single, double, or triple knockouts of the Y1, Y2, and Y4 receptors on the dietary effects of fat in mice are reported. PMID: 16380472
  37. NPY controls the release and synthesis of catecholamine from the adrenal medulla and consequently contributes to the sympathoadrenal tone PMID: 16798884
  38. Y1, Y2, and Y4 receptors are not crucially involved in NPY's hyperphagic, hypogonadal, and obesogenic effects, but they are responsible for the central regulation of circulating insulin levels by NPY. PMID: 16873543
  39. The Y1 receptor has a major role in neural tube closure. The teratogenic effect of PYY is exerted at the biologically active dose and involves a specific mechanism mediated by the Y1 receptor. PMID: 17400914
  40. Y1 receptor pathways act powerfully to inhibit bone production and adiposity by nonhypothalamic pathways, with potentially direct effects on bone tissue through a single pathway with Y2 receptors PMID: 17491016
  41. greater number of mesenchymal progenitors and the altered Y1 receptor expression within bone cells in the absence of Y2 receptors are a likely mechanism for the greater bone mineralization PMID: 17491022
  42. Transgenic NPY(1)R/LacZ FVB mice show a sexual dimorphism both on energy intake and on nucleus-specific regulation of the NPY Y(1)R system in the hypothalamus. PMID: 17584829
  43. these data provide a detailed and comparative mapping of Y(1) and Y(5) receptor promoter activity within cells of the mouse brain PMID: 17614946
  44. In mouse chromaffin cells, NPY evokes catecholamine release by the activation the NPY Y1 receptor, in a Ca2+-dependent manner, by activating mapK and nitric oxide production. PMID: 17868303
  45. Y1R is necessary for the anxiolytic-like effects of icv NPY, but not for the antidepressant-like or neurogenesis-inducing effects of fluoxetine. PMID: 17891380
  46. Together these results indicate that NPY and the Y1 receptor are required for the normal proliferation of adult olfactory precursors and olfactory function. PMID: 18088353
  47. Mice deficient in Y1Rs or Y2Rs have fewer Ki-67-immunoreactive proliferating precursor cells and doublecortin-ir neuroblasts in the SVZ and RMS than WT mice, and less calbindin-, calretinin-, and tyrosine hydroxylase-ir interneurons in the OB. PMID: 18305161
  48. NPY may elicit TGF-beta1 production in RAW264.7 cells via Y1 receptor, and the activated PI3K pathway may account for this effect. PMID: 18500388
  49. Npy1r-deficient mice display elevated IgM and IgG1 antigen-specific antibody response PMID: 18802344
  50. Chronically elevated NPY levels leaded to a modulation of the level of Y2 receptor expression and negative regulation of Y1 receptor expression. PMID: 19459152

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
The alpha form is highly expressed in the brain, heart, kidney, spleen, skeletal muscle, and lung, whereas the beta receptor mRNA was not detected in these tissues. However, the beta form is expressed in mouse embryonic developmental stage (7 and 11 days)
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1