Recombinant Mouse Nociceptin receptor (Oprl1)

Code CSB-CF016360MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Oprl1; Oor; Oprl; Nociceptin receptor; K3 opiate receptor; Kappa-type 3 opioid receptor; KOR-3; ORGC; Orphanin FQ receptor
Species
Mus musculus (Mouse)
Expression Region
1-367
Target Protein Sequence
MESLFPAPFWEVLYGSHFQGNLSLLNETVPHHLLLNASHSAFLPLGLKVTIVGLYLAVCI GGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGNALC KTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASVVGV PVAIMGSAQVEDEEIECLVEIPAPQDYWGPVFAICIFLFSFIIPVLIISVCYSLMIRRLR GVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVLVQGLGVQPGSETAVAILRF CTALGYVNSCLNPILYAFLDENFKACFRKFCCASALHREMQVSDRVRSIAKDVGLGCKTS ETVPRPA
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
G-protein coupled opioid receptor that functions as receptor for the endogenous neuropeptide nociceptin. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Signaling via G proteins mediates inhibition of adenylate cyclase activity and calcium channel activity. Arrestins modulate signaling via G proteins and mediate the activation of alternative signaling pathways that lead to the activation of MAP kinases. Plays a role in modulating nociception and the perception of pain. Plays a role in the regulation of locomotor activity by the neuropeptide nociceptin.
Gene References into Functions
  1. nociceptin opioid receptor agonists are promising drugs for treating pain in sickle cell anemia. PMID: 26294734
  2. These knock-in mice have NOP receptors that function both in vitro and in vivo and have provided a detailed characterization of NOP receptors in brain, spinal cord, and DRG neurons. PMID: 26290245
  3. Oprl1 is associated with amygdala function, fear processing, and posttraumatic stress disorder symptoms. PMID: 23740899
  4. Data suggest that NOPR and MOPR (mu-type opioid receptor) in spinal cord independently drive antinociception; NOPR/MOPR ligands attenuate neuropathic/inflammatory pain and have high antinociceptive potency with low tolerance development. PMID: 23652222
  5. Data suggest that nociceptin receptor/nociceptin signaling plays a role in the disease pathogenesis of inflammatory bowel diseases. PMID: 22449384
  6. The results of this study demonstrated the contribution of the NOP receptor in controlling food intake and meal pattern, as well as glutamate release and GIRK1 channel activity at POMC synapses. PMID: 20510254
  7. These results suggest differential requirements for ORL(1) in the mediation of neuroimmune effects exerted at different times after an immune challenge. PMID: 19913923
  8. OPR is not crucial for development of either acute or neuropathic nociceptive responses, or for the regulation of full receptor-mediated responses to opioid agonists PMID: 12217419
  9. The region-specific up-regulation of the opioid receptor-like 1 receptor indicates a tonic role for nociceptin/orphanin FQ in some brain structures and may suggest the peptide regulates the receptor expression in these regions. PMID: 12605902
  10. Place cells in nociceptin receptor knockout mice were abnormal in several ways: they were less stable, had noisier positional firing patterns, larger firing fields and higher discharge rates inside and outside the firing fields PMID: 15774528
  11. NOC receptor is involved in hippocampal cholinergic function PMID: 15979594
  12. RGS19 prefers regulating ORL1 receptor signaling over other opioid receptors, and the N-terminal domain of RGS19 plays a crucial role in its receptor preference PMID: 16219326
  13. nociceptin receptor has a role in the antinociceptive action of nitrous oxide PMID: 16931689
  14. Nociceptin released from interneurons by their high-frequency activation is a novel endogenous neuromodulator that negatively regulates induction of long-term potentiation in the hippocampus through direct modulation of pyramidal cells. PMID: 17475793
  15. the ability of buprenorphine to interact with the ORL1 receptor modulates its acute motor stimulatory and rewarding effects. PMID: 18634857
  16. findings demonstrate the existence of functional antagonism between nociceptin opioid peptide receptor and NMDA receptors that predominantly contributes to modulation of conditioned fear learning which involves spatial-processing demands PMID: 19100850
  17. Mice lacking the influence of endogenous N/OFQ are hypersensitive to nicotine in most measures, showing a role of endogenous nociceptin in modulating or mediating the acute effects of nicotine, and possibly nicotine addiction. PMID: 19371589

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
In the brain, isoform KOR3 and isoform KOR3C are most abundant in hypothalamus and periaqueductal gray. Isoform KOR3A is highly expressed in cortex, striatum and brainstem. Isoform KOR3D is highly expressed in cerebellum, hypothalamus and brainstem. Detec
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1