Recombinant Mouse Orexin receptor type 2 (Hcrtr2)

Code CSB-CF010232MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Hcrtr2; Mox2r; Orexin receptor type 2; Ox-2-R; Ox2-R; Ox2R; Hypocretin receptor type 2
Species
Mus musculus (Mouse)
Expression Region
1-460
Target Protein Sequence
MSSTKLEDSLSRRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAG YIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETW FFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVVIWIVS CIIMIPQAIVMECSSMLPGLANKTTLFTVCDEHWGGEVYPKMYHICFFLVTYMAPLCLMI LAYLQIFRKLWCRQIPGTSSVVQRKWKQQQPVSQPRGSGQQSKARISAVAAEIKQIRARR KTARMLMVVLLVFAICYLPISILNVLKRVFGMFTHTEDRETVYAWFTFSHWLVYANSAAN PIIYNFLSGKFREEFKAAFSCCLGVHHRQGDRLARGRTSTESRKSLTTQISNFDNVSKLS EHVVLTSISTLPAANGAGPLQNWYLQQGVPSSLLSTWLEV
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Nonselective, high-affinity receptor for both orexin-A and orexin-B neuropeptides. Triggers an increase in cytoplasmic Ca(2+) levels in response to orexin-A binding.
Gene References into Functions
  1. In an heart failure model, HCRTR2-deficient mice exhibited poorer cardiac function, worse treadmill exercise capacity, and greater myocardial scarring PMID: 26653627
  2. orexin activation of OX2R in the brain centrally enhances bone formation by lowing circulating leptin level. PMID: 24794976
  3. Knocking down the Orx2 receptors in the basolateral amygdala increased anxious behavior as measured by reduced social preference and reduced time spent in the center of an open field. PMID: 24485472
  4. OX2R activation induces PKC-mediated ERK and CREB phosphorylation. PMID: 22652455
  5. In the hypothalamus, the OX2 receptors have an inhibitory role in modulating basal concentrations of NE, ACh, and Hist. In the prefrontal cortex, the evoked release of the monoamines NE, 5-HT, and DA seems to be controlled negatively by OX2 receptors. PMID: 22038504
  6. Mice lacking OX2R signaling had poor maintenance of wakefulness indicative of sleepiness and fragmented sleep and lacked any electrophysiological response to orexin-A in the wake-promoting neurons of the tuberomammillary nucleus. PMID: 21368172
  7. activation of orexin neurons through OX2R might have an important role in the maintenance of arousal. PMID: 20861370
  8. Regulation of sleep/wake states is completely achieved by OX(2)R-expressing neurones without involving H(1)R-mediated pathways. Maintenance of basal physiological sleep/wake states is fully achieved without both H(1) and OX(1) receptors. PMID: 19694625
  9. So, the SAF diet can alter adipocytic adiposity-related gene expression and result in effective amelioration of diet-induced obesity. PMID: 20213045
  10. hypocretin receptor 2 mRNA levels declined with age in the hippocampus, thalamus, pons, and medulla (hypocretin receptor 2) PMID: 12399012
  11. OX2alphaR is expressed in various areas of the mouse brain and has low expression in caudal part of cerebellum PMID: 16806113
  12. The enhanced orexin-orexin receptor2 signaling confers resistance to diet-induced features of the metabolic syndrome through negative energy homeostasis and improved leptin sensitivity. PMID: 19117547
  13. Biochemical and behavioural characterization of EMPA, a novel high-affinity, selective antagonist for the OX(2) receptor. PMID: 19751316

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Widely expressed. Isoform 2 not detected in skeletal muscle and kidney.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1