Recombinant Mouse Organic solute transporter subunit alpha (Osta)

Code CSB-CF851240MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Slc51a
Uniprot No.
Alternative Names
Slc51a; Osta; Organic solute transporter subunit alpha; OST-alpha; Solute carrier family 51 subunit alpha
Species
Mus musculus (Mouse)
Expression Region
1-340
Target Protein Sequence
MEPGRTHIKLDPRYTAELLELLETNYSISPACFSHPPTAAQLLRALGPVDIALTIILTFL TTGSVAIFLEDAVYLYKNTLCPIKKRTLIWSSSAPTVVSVFCCFGLWIPRALTLVEMAIT SFYAVCFYLLMMVMVEGFGGKKAVLRTLKDTPMRVHTGPCCCCCPCCPPLILTRKKLQLL LLGPFQYAFFKITLSIVGLFLIPDGIYDPGEISEKSAALWINNLLAVSTLLALWSLAILF RQAKMHLGEQNMGSKFALFQVLVILTALQPAIFSILANSGQIACSPPYSSKIRSQVMNCH MLILETFLMTVLTRMYYRRKDDKVGYEACSLPDLDSALKA
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood. Efficiently transports the major species of bile acids.
Gene References into Functions
  1. Data suggest that transport of bile acid taurocholate is retained when OstB (organic solute transporter beta subunit) is truncated to contain only the transmembrane domain with 15 additional residues on each side and co-expressed with intact OstA; shorter fragments of OstB are inactive. PMID: 28455390
  2. These findings indicate that loss of OSTalpha protects against age-related weight gain and insulin resistance. PMID: 24381083
  3. Ileal FGF15 expression was directly correlated with plasma cholesterol levels and aortic cholesterol content. In contrast, plasma and hepatic cholesterol levels and atherosclerosis development were not reduced in apoE(-/-) mice deficient in Ostalpha. PMID: 23880190
  4. Total ileal FGF15 expression was elevated almost 20-fold in Ostalpha(-/-) mice as a result of increased villus epithelial cell number and ileocyte FGF15 protein expression PMID: 22542490
  5. Inactivation of FXR largely unmasked the bile acid malabsorption phenotype and corrected the bile acid homeostasis defect in Ostalpha null mice. PMID: 21691100
  6. Ostalpha-deficient mice efficiently eliminate excess bile acids via the feces. PMID: 21719738
  7. OSTalpha is localized to steroidogenic cells of the brain and adrenal gland, and it modulates DHEA/DHEAS homeostasis PMID: 20649839
  8. These findings indicate that loss of Ostalpha provides protection from liver injury in obstructive cholestasis through adaptive responses in both the kidney and liver that enhance clearance of bile acids into urine. PMID: 19902485
  9. Co-expression of mouse Ostalpha-Ostbeta, but not the individual subunits, stimulated Na(+)-independent bile acid uptake and the apical-to-basolateral transport of taurocholate PMID: 15563450
  10. OSTalpha and OSTbeta mRNA levels were induced in the adrenals and kidneys of wild-type, but not FXR-/-, mice PMID: 16251721
  11. the selective localization of OSTalpha and OSTbeta to the basolateral plasma membrane of epithelial cells responsible for bile acid and sterol reabsorption. PMID: 16317684
  12. In conclusion, we identified Ost-alpha/Ost-beta as a novel FXR target. Absent Ost-alpha/Ost-beta induction in CA-fed FXR(-/-) animals may contribute to increased liver injury in these animals. PMID: 16357057
  13. The mouse Ostalpha and Ostbeta promoters are unusual in that they contain functional FXR and LRH elements, which mediate, respectively, positive and negative feedback regulation by bile acids. PMID: 16357058
  14. These results indicate that expression of Ostalpha and Ostbeta are highly regulated in response to cholestasis and that this response is dependent on the FXR bile acid receptor. PMID: 16423920
  15. LXRalpha transcriptionally regulate mouse organic solute transporter alpha/beta via inverted repeat-1 elements shared with farnesoid X receptor PMID: 17177110
  16. Present as heterodimers (with Ost beta) and/or heteromultimers; the interaction between Ostalpha and Ostbeta increases the stability of the proteins and is required for delivery of the heteromeric complex to the plasma membrane. PMID: 17650074
  17. These data indicate that Ostalpha-Ostbeta is essential for intestinal bile acid transport in mice. PMID: 18292224
  18. These findings provide direct support for the hypothesis that Ostalpha-Ostbeta is a major basolateral transporter of bile acids and conjugated steroids in the intestine, kidney, and liver. PMID: 18497332

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Note=Mainly restricted to the lateral and basal membranes of ileal enterocytes. Transported from the endoplasmic reticulum to the plasma membrane upon interacting with SLC51B.
Protein Families
OST-alpha family
Tissue Specificity
Present at high levels in ileum. In ileum, it is restricted to the apical domain on the mature villus enterocytes with little detectable expression in the goblet cells or crypt enterocytes (at protein level). Expressed in kidney but not in heart, brain, l
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1