Recombinant Mouse G-protein coupled receptor 68 (Gpr68)

Code CSB-CF805861MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Gpr68; Ogr1; Ovarian cancer G-protein coupled receptor 1; G-protein coupled receptor 68; Sphingosylphosphorylcholine receptor
Species
Mus musculus (Mouse)
Expression Region
1-365
Target Protein Sequence
MGNITTENSSLSCPIDHTIHQTLAPVVYVTVLVVGFPANCLSLYFGYLQIKARNELGVYL CNLTIADLFYICSLPFWLQYVLQHDDWSHGDLSCQVCGILLYENIYISVGFLCCISIDRY LAVAHPFRFHQFRTLKAAVGVSVLIWAKELLTSIYFLNHKEVIEDEDQHRVCFEHYPIQA WQRSINYYRFLVGFLFPICLLLASYQGILRAVRRSHGTQKSRKDQIQRLVLSTVVIFLAC FLPYHVLLLVRSLWERNCEFAKSIFNVYHFSLLLTSFNCVADPVLYCFVSETTHRDLARL RGACLAVLTCSRTSRAREAYPLGAPEASGKSGAQGEEPELLTKLHSAFQTPSSLGVGGPS TVGLA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Proton-sensing receptor involved in pH homeostasis. May represents an osteoblastic pH sensor regulating cell-mediated responses to acidosis in bone. Mediates its action by association with G proteins that stimulates inositol phosphate (IP) production or Ca(2+) mobilization. The receptor is almost silent at pH 7.8 but fully activated at pH 6.8. Also functions as a metastasis suppressor gene in prostate cancer.
Gene References into Functions
  1. The signal transduction activity of OGR1 is regulated by pH-dependent internalization and recycling to the plasma membrane. PMID: 29655915
  2. In rapidly growing mice, lack of OGR1 leads to increased bone mass with increased bone turnover and a greater increase in bone formation than resorption. PMID: 26880453
  3. Here, we demonstrate that metals, Fe, Zn, Co, Ni and Mn are the novel OGR1 agonists, which can singly activate OGR1 in neutral pH. PMID: 26053506
  4. CaSR and OGR1 reciprocally inhibit signaling through each other in central neurons, and that this is lost in their transformed counterparts. Acidification potentiates OGR1. PMID: 26261299
  5. acidic pH stimulates cGMP accumulation preferentially through the OGR1/Gq/11 proteins/phospholipase C/Ca(2+)/nNOS in N1E-115 neuronal cells. Akt-mediated phosphorylation of nNOS PMID: 25025574
  6. OGR1 on dendritic cells is critical for their migration to draining lymph nodes, which, in turn, stimulates Th2 phenotype change and subsequent induction of airway inflammation and hyperreactivity. PMID: 24244587
  7. Deficiency of proton-sensing ovarian cancer G protein-coupled receptor 1 attenuates glucose-stimulated insulin secretion. PMID: 22733973
  8. OGR1 alters the pH-sensitive response of NHE and H+-ATPase activity in proximal tubules. PMID: 22508039
  9. regulator of G-protein signaling 18 acts as a negative regulator of the acidosis-induced osteoclastogenic OGR1/NFAT signaling pathway PMID: 17576169
  10. OGR1 induces an increase in Ca(i) in response to acidic medium and is a prime candidate for an osteoblast proton sensor. PMID: 18847331
  11. OGR1's role in osteoclastogenesis is not strong enough to affect overall bone development. PMID: 19479052

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed in the lung, testis, heart, brain, spleen, thymus, brown fat, small intestine, colon, peripheral blood leukocytes, macrophages, stomach, ovary and white fat but not in the liver, kidney, and skeletal muscle. Expression in the prostate is weak bu
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1