Recombinant Mouse Ovarian cancer G-protein coupled receptor 1(Gpr68)

Code CSB-CF805861MO
Size Pls inquire other sizes
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names Gpr68
Uniprot No. Q8BFQ3
Alternative Names Gpr68; Ogr1; Ovarian cancer G-protein coupled receptor 1; G-protein coupled receptor 68; Sphingosylphosphorylcholine receptor
Species Mus musculus (Mouse)
Expression Region 1-365
Target Protein Sequence MGNITTENSSLSCPIDHTIHQTLAPVVYVTVLVVGFPANCLSLYFGYLQIKARNELGVYL CNLTIADLFYICSLPFWLQYVLQHDDWSHGDLSCQVCGILLYENIYISVGFLCCISIDRY LAVAHPFRFHQFRTLKAAVGVSVLIWAKELLTSIYFLNHKEVIEDEDQHRVCFEHYPIQA WQRSINYYRFLVGFLFPICLLLASYQGILRAVRRSHGTQKSRKDQIQRLVLSTVVIFLAC FLPYHVLLLVRSLWERNCEFAKSIFNVYHFSLLLTSFNCVADPVLYCFVSETTHRDLARL RGACLAVLTCSRTSRAREAYPLGAPEASGKSGAQGEEPELLTKLHSAFQTPSSLGVGGPS TVGLA
Protein Length full length protein
Tag Info The following tags are available.
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Target Data

Function Proton-sensing receptor involved in pH homeostasis. May represents an osteoblastic pH sensor regulating cell-mediated responses to acidosis in bone. Mediates its action by association with G proteins that stimulates inositol phosphate (IP) production or Ca(2+) mobilization. The receptor is almost silent at pH 7.8 but fully activated at pH 6.8. Function also as a metastasis suppressor gene in prostate cancer.
Gene References into Functions
  1. The signal transduction activity of OGR1 is regulated by pH-dependent internalization and recycling to the plasma membrane. PMID: 29655915
  2. In rapidly growing mice, lack of OGR1 leads to increased bone mass with increased bone turnover and a greater increase in bone formation than resorption. PMID: 26880453
  3. Here, we demonstrate that metals, Fe, Zn, Co, Ni and Mn are the novel OGR1 agonists, which can singly activate OGR1 in neutral pH. PMID: 26053506
  4. CaSR and OGR1 reciprocally inhibit signaling through each other in central neurons, and that this is lost in their transformed counterparts. Acidification potentiates OGR1. PMID: 26261299
  5. acidic pH stimulates cGMP accumulation preferentially through the OGR1/Gq/11 proteins/phospholipase C/Ca(2+)/nNOS in N1E-115 neuronal cells. Akt-mediated phosphorylation of nNOS PMID: 25025574
  6. OGR1 on dendritic cells is critical for their migration to draining lymph nodes, which, in turn, stimulates Th2 phenotype change and subsequent induction of airway inflammation and hyperreactivity. PMID: 24244587
  7. Deficiency of proton-sensing ovarian cancer G protein-coupled receptor 1 attenuates glucose-stimulated insulin secretion. PMID: 22733973
  8. OGR1 alters the pH-sensitive response of NHE and H+-ATPase activity in proximal tubules. PMID: 22508039
  9. regulator of G-protein signaling 18 acts as a negative regulator of the acidosis-induced osteoclastogenic OGR1/NFAT signaling pathway PMID: 17576169
  10. OGR1 induces an increase in Ca(i) in response to acidic medium and is a prime candidate for an osteoblast proton sensor. PMID: 18847331
  11. OGR1's role in osteoclastogenesis is not strong enough to affect overall bone development. PMID: 19479052

Show More

Hide All

Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Expressed in the lung, testis, heart, brain, spleen, thymus, brown fat, small intestine, colon, peripheral blood leukocytes, macrophages, stomach, ovary and white fat but not in the liver, kidney, and skeletal muscle. Expression in the prostate is weak bu
Database Links

KEGG: mmu:238377

STRING: 10090.ENSMUSP00000057510

UniGene: Mm.32160

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1