Recombinant Mouse P2X purinoceptor 4(P2rx4),partial

Code CSB-CF884934MOa2
Product Type Transmembrane Protein
Size US$1235
Uniprot No. Q9JJX6
Relevance Receptor for ATP that acts as a ligand-gated ion channel. This receptor is insensitive to the antagonists PPADS and suramin (By similarity).
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence QETDSVVSSVTTKAKGVAVTNTSQLGFRIWDVADYVVPAQEENSLFIMTNMIVTVNQTQGTCPEIPDKTSICDSDANCTLGSSDTHSSGIGTGRCVPFNASVKTCEVAAWCPVENDAGVPTPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTSYLKSCIYNARTDPFCPIFRLGQIVADAGHSFQEMAVEGGIMGIQIKWDCNLDRAASHCLPRYSFRRLDTRDLEHNVSPGYNFRFAKYYRDLAGNEQRTLTKAYGIRFDIIVFGKAGKFDIIPTMIN
Research Area others
Source in vitro E.coli expression system
Gene Names P2rx4
Protein Names ATP receptor Purinergic receptor
Expression Region 55-338aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 47.5kDa
Protein Description Extracellular Domain
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for ATP that acts as a ligand-gated ion channel. This receptor is insensitive to the antagonists PPADS and suramin (By similarity).
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families P2X receptor family
Database Links

STRING: 10090.ENSMUSP00000031429

UniGene: Mm.290884

Pathway Calcium signaling pathway

Related Products

P2rx4 Proteins

P2rx4 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.