Recombinant Mouse P2Y purinoceptor 14(P2ry14)

Code CSB-CF887673MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9ESG6
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Mus musculus (Mouse)
Sequence MNNSTTTDPPNQPCSWNTLITKQIIPVLYGMVFITGLLLNGISGWIFFYVPSSKSFIIYL KNIVVADFLMGLTFPFKVLGDSGLGPWQVNVFVCRVSAVIFYVNMYVSIVFFGLISFDRY YKIVKPLLTSIVQSVNYSKLLSVLVWMLMLLLAVPNIILTNQGVKEVTKIQCMELKNELG RKWHKASNYIFVSIFWVVFLLLIVFYTAITRKIFKSHLKSRKNSTSVKRKSSRNIFSIVL VFVVCFVPYHIARIPYTKSQTEGHYSCRTKETLLYAKEFTLLLSAANVCLDPIIYFFLCQ PFREVLNKKLHMSLKVQNDLEVSKTKRENAIHESTDTL
Source in vitro E.coli expression system
Gene Names P2ry14
Protein Names Recommended name: P2Y purinoceptor 14 Short name= P2Y14 Alternative name(s): G-protein coupled receptor 105 UDP-glucose receptor
Expression Region 1-338
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for UDP-glucose coupled to G-proteins.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

KEGG: mmu:140795

STRING: 10090.ENSMUSP00000066669

UniGene: Mm.439021

Related Products

P2ry14 Proteins

P2ry14 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.