Recombinant Mouse P2Y purinoceptor 4 (P2ry4)

Code CSB-CF888329MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
P2ry4; P2y4r; P2Y purinoceptor 4; P2Y4
Species
Mus musculus (Mouse)
Expression Region
1-361
Target Protein Sequence
MTSADSLLFTSLGPSPSSGDGDCKFNEEFKFILLPLSYAVVFVLGLALNAPTLWLFLFRL RPWDATATYMFHLALSDTLYVLSLPTLVYYYAARNHWPFGTGFCKFVRFLFYWNLYCSVL FLTCISVHRYMGICHPLRAIRWGRPRFAGLLCLGVWLVVAGCLVPNLFFVTTNANGTTIL CHDTTLPEEFDHYVYFSSTIMVLLFGFPFLITLVCYGLMARRLYRPLPGAGQSSSRLRSL RTIAVVLTVFAVCFVPFHITRTIYYLARLLNAECRVLNIVNVVYKVTRPLASANSCLDPV LYLFTGDKYRNQLQQLCRGSTPKRRTTASSLALVTLHEESISRWADIHQDSIFPAYEGDR L
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for ATP and UTP coupled to G-proteins that activate a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
  1. These data highlight the P2Y4 receptor as an inhibitor of cardiac fat formation PMID: 27855539
  2. In the brain samples, expressions of P2Y4 and P2X7 were significantly reduced, whereas that of P2Y1 was significantly elevated in an age-dependent manner. PMID: 28322086
  3. Data show that activation of nucleotide receptor P2Y4 (P2Y4) in the differentiating embryonic stem cells (ESCs) resulted in an increased proportion of neurons expressing vesicular glutamate transporter (vGluT). PMID: 26972684
  4. present study defines the P2Y4 nucleotide receptor, expressed on cardiac microvascular endothelial cells and involved in postnatal heart development, as an important regulator of the inflammatory response to cardiac ischemia PMID: 25595790
  5. Amyloid beta peptide 1-42 induced self-uptake in microglia through pinocytosis, a process involving activation of P2Y4 receptors by autocrine ATP signaling. PMID: 24001770
  6. P2Y(4) receptor could constitute an important regulator of acute and chronic response to exercise. PMID: 22865387
  7. study uncovers mouse P2Y(4) receptor as an essential regulator of cardiac endothelial cell function, and illustrates the involvement of endothelial-cardiomyocyte interactions in post-natal heart development PMID: 22437266
  8. Purinergic receptors might represent important new set of molecular targets for theca hyperplasia and polycystic ovarian syndrome. PMID: 20630102
  9. Knock-out mice reveal tissue-specific roles of P2Y receptor subtypes in different epithelia. PMID: 12644577
  10. Purinergic receptors on microglial cells: functional expression in acute brain slices and modulation of microglial activation in vitro. PMID: 12814360
  11. Both the P2Y2 and P2Y4 receptors are present in the luminal membrane of mouse distal colonic mucosa, and stimulation of these receptors leads to potassium ion secretion. PMID: 15718265
  12. The role of P2Y2 and P2Y4 receptors in peritoneal macrophage calcium signaling is reported. PMID: 16980298
  13. Functional purinergic (P2Y4) neuron-glia communication in the enteric nervous system is shown, raising the possibility that ATP released with neurotransmitters during enteric synaptic transmission functions to signal to enteric glia. PMID: 19250649
  14. AQP2-mediated water transport is downregulated not only by basolateral nucleotides, mediated by P2Y(2) receptors, but also by luminal nucleotides, mediated by P2X(2) and/or P2Y(4) receptors. PMID: 19423692

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed in the liver, intestine, stomach, bladder and lung.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×