Recombinant Mouse Pannexin-1 (Panx1)

Code CSB-CF867490MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Panx1; Pannexin-1
Species
Mus musculus (Mouse)
Expression Region
1-426
Target Protein Sequence
MAIAHLATEYVFSDFLLKEPTEPKFKGLRLELAVDKMVTCIAVGLPLLLISLAFAQEISI GTQISCFSPSSFSWRQAAFVDSYCWAAVQQKSSLQSESGNLPLWLHKFFPYILLLFAILL YLPALFWRFSAAPHLCSDLKFIMEELDKVYNRAIKAAKSARDLDLRDGPGPPGVTENVGQ SLWEISESHFKYPIVEQYLKTKKNSSHLIMKYISCRLVTFVVILLACIYLSYYFSLSSLS DEFLCSIKSGVLKNDSTIPDRFQCKLIAVGIFQLLSLINLIVYALLIPVVVYTFFIPFRQ KTDILKVYEILPTFDVLHFKSEGYNDLSLYNLFLEENISELKSYKCLKVLENIKSNGQGI DPMLLLTNLGMIKMDIIDGKIPTSLQTKGEDQGSQRVEFKDLDLSSEAAANNGEKNSRQR LLNPSC
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Structural component of the gap junctions and the hemichannels. May play a role as a Ca(2+)-leak channel to regulate ER Ca(2+) homeostasis.; Structural component of the gap junctions and the hemichannels involved in the ATP release and nucleotide permeation. May play a role as a Ca(2+)-leak channel to regulate ER Ca(2+) homeostasis. Plays a critical role in oogenesis.
Gene References into Functions
  1. Panx1 expressed in immune cells is critical for pain-like effects following nerve injury in mice, perhaps via a GPCR-mediated activation mechanism, and suggest that inhibition of Panx1 may be useful in treating neuropathic pain. PMID: 28195232
  2. Auditory brainstem response thresholds in the Gen-Panx1 KO mouse were significantly increased. Distortion product otoacoustic emission and cochlear microphonics were significantly reduced. PMID: 29710868
  3. These novel findings reveal unique roles for GFAP-positive glial and neuronal Panx1 and describe new chronic pain targets for cell-type specific intervention in this often intractable disease. PMID: 27910899
  4. Panx-1 modulation may be interesting to amplify the clinical effect of cisplatin (DDP) and reverse the resistance of testicular cancer cells to DDP. PMID: 28780469
  5. Pannexin1 may play a role in the pathogenesis of liver disease. PMID: 29246445
  6. Findings indicate a deleterious role for membrane channel Pannexin 1 (Panx1) in response to permanent permanent middle cerebral artery (MCA) occlusion, that is unique to females. PMID: 28445139
  7. ATP release from red blood cells is not mediated by the cAMP-mediated Panx1 pathway. PMID: 28855161
  8. blocking Panx1 and/or Casp4 activities is a beneficial strategy to enhance donor cell engraftment and LG regeneration through the reduction of inflammation. PMID: 29098296
  9. found a significant increase in waking and a correspondent decrease in slow wave sleep percentages in the Panx1-/- animals. PMID: 27769744
  10. Diabetic C57BL/6J-Ins2Akita mice were used to evaluate in vivo effects of high glucose on P2R and Panx1 PMID: 27159053
  11. Pharmacological blockade or genetic deletion of Panx1 channels inhibits CD4+ T lymphocyte polarization and migration induced by the chemokine SDF-1alpha/CXCL12. Panx1 deficiency delayed experimental autoimmune encephalomyelitis symptoms because of the decreased infiltration of CD4+ T lymphocytes into the CNS. PMID: 27076682
  12. data suggest that Panx1 and Panx3 are not essential for baseline hearing in mice tested, but the therapeutic targeting of Panx3 may prove protective against mid-high-frequency hearing loss caused by loud NE. PMID: 27784763
  13. Pannexin1 (Panx1) is dynamically regulated throughout mammary gland development. PMID: 27099931
  14. Panx1 is expressed in the central and peripheral nervous system during early developmental stages. PMID: 26453396
  15. this study provides the first demonstration of Panx1 channel morphology and assembly in intact cells. PMID: 26386583
  16. Panx1 in the heart influences different electrophysiological parameters involving depolarization, repolarization and atrial vulnerability causing atrial fibrillation. PMID: 26828725
  17. ATP released by myocardial cells through Pannexin-1 channel during ischemia could evoke calcium responses in cardiac sympathetic nerve fibers. PMID: 26596404
  18. Platelets of Panx1-/- mice showed reduced collagen-induced aggregation as compared to those of WT mice. PMID: 25947940
  19. The observations of this study reveal a new role for Panx1 in NPC maintenance in the VZ and suggesting that targeting peri-infarct Panx1 (in combination with other interventions) could improve outcomes after stroke. PMID: 26818508
  20. The role of Pannexin 1 is analyzed at the systems level, it is not required for normal taste perception. Further studies are needed to determine the role of this hemichannel in taste cells. PMID: 26126730
  21. Panx1 channels promote leukocyte adhesion and emigration through the venous wall during acute systemic inflammation. PMID: 26242575
  22. The PANX1 is unnecessary for taste detection and consequently that ATP release from Type 2 taste cells does not require PANX1. PMID: 25987548
  23. Pannexin1 channels dominate ATP release in the cochlea ensuring endocochlear potential and auditory receptor potential generation and hearing PMID: 26035172
  24. But not in Casp11(-/-), Panx1(-/-), or P2x7(-/-) mice. PMID: 26572062
  25. Px1 channels releasing ATP have any role in the constrictor actions of alpha1-adrenoceptor activation PMID: 25637780
  26. A molecular signature in the pannexin1 intracellular loop confers channel activation by the alpha1 adrenoreceptor in smooth muscle cells. PMID: 25690012
  27. Hydrolysable ATP is the most potent stimulator of Panx1 internalization. Two possible mechanisms for Panx1 internalization include activation of P2X receptors and involvement of a putative ATP-sensitive residue in the first extracellular loop of Panx1. PMID: 26195825
  28. These findings indicate that Panx1 participates in urothelial mechanotransduction and signaling by providing a direct pathway for mechanically-induced ATP release and by functionally interacting with P2X7Rs PMID: 25170954
  29. Deletion of Panx1 in the cochlea could produce a progressive hearing loss. The auditory brainstem response (ABR) recording showed that hearing loss was moderate to severe and severe at high-frequencies. PMID: 26002464
  30. activation of Panx1/P2X7 purinoceptors appears to play a significant role in the neuroprotective mechanism of ischemic postconditioning. PMID: 25796110
  31. Application of P1-receptor antagonist and apyrase significantly reduced this component in WT, but not in KO mice, indicating participation of ATP released via Panx1 in the EDH-like relaxation. PMID: 25819435
  32. These results show that P2X7 receptors and pannexin-1 channels are major mediators of postanoxic depolarization in neurons and of brain damage after ischemia PMID: 25605289
  33. The two channel states were associated with different reactivities of the terminal cysteine of Panx1 to thiol reagents, suggesting different conformations. PMID: 25056878
  34. Study found that astrocytes released ATP in response to mechanical strain, with pannexin 1 the predominant efflux pathway PMID: 24839011
  35. The cytoplasmic domains of pannexin 1 is transmembrane domains uncovered a potential membrane interacting region (I360-G370) located upstream of the caspase cleavage site (D375-D378) within the pannexin 1 CT domain. PMID: 24751934
  36. Panx1 channels serves as the main cell membrane pathway for ATP-induced uptake of small molecules and mediates the ATP-induced T-cell death. PMID: 24590064
  37. The Panx1 C-terminus plays an important role in channel trafficking and highlight the complexity of molecular signals involved. PMID: 23659289
  38. 5-Lipoxygenase inhibitor activation of Panx1 channels involves activation of the thromboxane receptor via the cAMP/PKA pathway. PMID: 25080488
  39. This study's findings suggest a new function of Pannexin1 as an important player in normal endothelium-dependent regulation of arterial tone, where it facilitates vessel dilation and attenuates constriction. PMID: 24885326
  40. These findings suggest that nonmetal hapten reactivity to thiol residues causes membrane disruption of keratinocytes and reactive oxygen species production that leads to ATP release through opening of Panx hemichannels. PMID: 24531690
  41. We conclude that Panx1 controls cellular properties of keratinocytes and dermal fibroblasts during early stages of skin development and modulates wound repair upon injury. PMID: 24522432
  42. This report provides immunocytological and functional evidence for a role of Panx1 HCs in adult skeletal muscles. PMID: 23583931
  43. data identify a novel linkage between an antibiotic, pannexin channels and cellular integrity, and suggest that re-engineering certain quinolones might help develop newer antibacterials PMID: 24646995
  44. shows that a Panx1 dependent mechanism (ATP release and/or inflammasome activation) contributes to disease progression, and that inhibition of Panx1 using pharmacology or gene disruption delays and attenuates clinical signs of EAE PMID: 23885286
  45. Panx1 regulates neural stem and progenitor cell behaviours associated with cytoskeletal dynamics and interacts with multiple cytoskeletal elements. PMID: 23964896
  46. propose that Panx1 signaling provides a positive feedback loop for inflammatory responses involved in bladder dysfunction in MS PMID: 23827947
  47. Panx1-/- mice carried much more F4/80lowGr1-Ly6C- cells in the peritoneal cavity, indicating that this population is neither inflammatory monocytes nor classical macrophages. PMID: 23549611
  48. The results of this study suggested that Panx1 channels serve as sinks for extracellular current flow making them possible candidates for the mediation of feedback from horizontal cells to photoreceptors. PMID: 22965528
  49. ). Pannexin double-knockout mice (Px1(-/-) Px2(-/-)) were less impaired in parameters such as exploration, anxiety, sensorimotor function and behavioral symmetry. PMID: 23111424
  50. Panx1 alone forms a channel that has insufficient permeability to ATP. PMID: 22956545

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Protein Families
Pannexin family
Tissue Specificity
Widely expressed, including in cartilage, skin, spleen and brain.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1