Recombinant Mouse Podoplanin(Pdpn)

Code CSB-CF017739MO(A4)
Size $554

Product Details

Target Names Pdpn
Uniprot No. Q62011
Species Mus musculus (Mouse)
Source in vitro E.coli expression system
Expression Region 23-172
Target Protein Sequence GTIGVNEDDIVTPGTGDGMVPPGIEDKITTTGATGGLNESTGKAPLVPTQRERGTKPPLEELSTSATSDHDHREHESTTTVKVVTSHSVDKKTSHPNRDNAGDETQTTDKKDGLPVVTLVGIIVGVLLAIGFVGGIFIVVMKKISGRFSP
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length Full Length of Mature Protein
Tag Info
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Datasheet & COA Please contact us to get it.
Still Have Questions? Leave a Message or Start an on-line Chat

Target Data

Function Mediates effects on cell migration and adhesion through its different partners. During development plays a role in blood and lymphatic vessels separation by binding CLEC1B, triggering CLEC1B activation in platelets and leading to platelet activation and/or aggregation
Subcellular Location Membrane, Single-pass type I membrane protein, Cell projection, lamellipodium membrane, Single-pass type I membrane protein, Cell projection, filopodium membrane, Single-pass type I membrane protein, Cell projection, microvillus membrane, Single-pass type I membrane protein, Cell projection, ruffle membrane, Single-pass type I membrane protein, Membrane raft, Apical cell membrane, Basolateral cell membrane, Cell projection, invadopodium
Protein Families Podoplanin family
Tissue Specificity Detected at high levels in lung and brain, at lower levels in kidney, stomach, liver, spleen and esophagus, and not detected in skin and small intestine. Expressed in epithelial cells of choroid plexus, ependyma, glomerulus and alveolus, in mesothelial ce
Database Links

KEGG: mmu:14726

STRING: 10090.ENSMUSP00000030317

UniGene: Mm.2976

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.