Recombinant Mouse Potassium channel subfamily K member 3 (Kcnk3)

Code CSB-CF012071MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Kcnk3
Uniprot No.
Alternative Names
Kcnk3; Ctbak; Task; Task1; Potassium channel subfamily K member 3; Acid-sensitive potassium channel protein TASK-1; Cardiac two pore background K(+ channel; TWIK-related acid-sensitive K(+ channel 1; Two pore potassium channel KT3.1; Two pore K(+ channel KT3.1; cTBAK-1
Species
Mus musculus (Mouse)
Expression Region
1-409
Target Protein Sequence
MKRQNVRTLALIVCTFTYLLVGAAVFDALESEPEMIERQRLELRQLELRARYNLSEGGYE ELERVVLRLKPHKAGVQWRFAGSFYFAITVITTIGYGHAAPSTDGGKVFCMFYALLGIPL TLVMFQSLGERINTFVRYLLHRAKRGLGMRHAEVSMANMVLIGFVSCISTLCIGAAAFSY YERWTFFQAYYYCFITLTTIGFGDYVALQKDQALQTQPQYVAFSFVYILTGLTVIGAFLN LVVLRFMTMNAEDEKRDAEHRALLTHNGQAVGLGGLSCLSGSLGDGVRPRDPVTCAAAAG GVGVGVGGSGFRNVYAEVLHFQSMCSCLWYKSREKLQYSIPMIIPRDLSTSDTCVEHSHS SPGGGGRYSDTPSHPCLCSGTQRSAISSVSTGLHSLAAFRGLMKRRSSV
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
pH-dependent, voltage-insensitive, background potassium channel protein. Rectification direction results from potassium ion concentration on either side of the membrane. Acts as an outward rectifier when external potassium concentration is low. When external potassium concentration is high, current is inward.
Gene References into Functions
  1. TASK-1 channels displayed strong cardiac expression in mice. Dysregulation of atrial TASK-1 expression in murine atrial fibrillation and heart failure models suggests potential relevance of TASK-1 currents in arrhythmogenesis. PMID: 29881975
  2. studies demonstrate that TASK channels can limit ischemia-reperfusion damage in the cortex, and postconditioning with volatile anesthetics provides neuroprotective actions that depend, in part, on activation of TASK currents in cortical neurons. PMID: 28276488
  3. Whereas adult female TASK-1-/- mice had a virtually normal respiratory phenotype, except for an increased relaxation time, adult male TASK-1-/- mice exhibited enhanced ventilation that was mainly due to an increased tidal volume. Respiratory responses to hypercapnia and hypoxia were largely preserved. In neonatal TASK-1-/- mice, respiratory drive appeared reduced and knockout animals were more prone to experience apnea. PMID: 27838333
  4. Acute hypercapnia (5% CO2) stimulated ventilation in TASK-1/3(-/-) and wild-type mice to a similar extent; however, at higher CO2 concentrations the stimulation of ventilation was more pronounced in TASK-1/3(-/-) mice. At hyperoxia (100% O2), TASK-1(-/-), TASK-3(-/-) and wild-type mice showed the physiological small decrease of ventilation. TASK-1/3(-/-) mice exhibited an abnormal increase of ventilation under hyperoxia. PMID: 28673876
  5. Our results have uncovered a previously unknown role of c-Src tyrosine kinase in regulating interneuron function in the brain and identified a novel mechanism by which TASK-1 channels are activated in neurons. PMID: 28714121
  6. Adipose-specific Kcnk3 knockout mice display increased energy expenditure and are resistant to hypothermia and obesity. PMID: 28988768
  7. While there is compelling evidence that TASK-1 is involved in the pathogenesis of pulmonary arterial hypertension in humans, the mouse does not appear to serve as a suitable model to study the underlying molecular mechanisms PMID: 28301582
  8. the K(+) channel TASK1 controls the thermogenic activity in brown adipocytes through modulation of beta-adrenergic receptor signaling. PMID: 26527067
  9. KCNK3 channels are not involved in hearing. PMID: 26549439
  10. An important role for TASK-1 channels in limiting pancreatic alpha-cell excitability and glucagon secretion during glucose stimulation. PMID: 25849724
  11. This study showed TASK channels on cholinergic neurons contribute to endogenous EEG oscillations (including gamma activity) and the electrocortical response to histamine at the basal forebrain in vivo. PMID: 26446210
  12. Downregulation of TASK_1 increased proliferation rates of N2A cells. PMID: 24848104
  13. A glucose-dependent role for beta-cell TASK-1 channels of limiting glucose-stimulated Deltapsip depolarization and insulin secretion, which modulates glucose homeostasis. PMID: 24932805
  14. Oxygen and mitochondrial inhibitors modulate both monomeric and heteromeric TASK-1 and TASK-3 channels in mouse carotid body type-1 cells. PMID: 24042502
  15. This study demonstrated for the first time that oligodendrocytes express functional TASK-1 channels and provide compelling evidence they contribute to oligodendrocyte damage in hypoxia. PMID: 23567653
  16. TASK-1 deficiency does neither alter key electrophysiological parameters nor increases atrial/ventricular vulnerability after electrical stimulation. PMID: 22813543
  17. No difference is found between the pulmonary artery (PA) of wild-type and TASK-1/3-deficient mice; TASK-1 does not form a functional channel in pulmonary artery smooth muscle cells. PMID: 21486782
  18. TASK-1 is important for the conduction of cardiac excitation and for the ventricular erpolarization under resting conditions of the heart. PMID: 21865850
  19. TASK channels are not required for the stimulation of aldosterone production by protons but their inhibition by physiological acidosis may contribute to full expression of the steroidogenic response. PMID: 21111026
  20. Our findings imply that TASK channels regulateFast-spiking neocortex cell rhythmogenesis PMID: 20705896
  21. TASK-1 plays a functional role in the repolarization of the cardiac action potential in vivo and contributes to the maintenance of heart rate variability. PMID: 20978771
  22. We have characterized the mouse carotid body with special attention to nicotinic, purinergic and dopaminergic receptors as well as the TASK-1 K(+)-channel PMID: 20452469
  23. A consequence of having TASK-1 channels expressed (in various non-neuronal tissues and organs) is that neuronal damage is lessened when stroke occurs. PMID: 20167264
  24. The data of this study indicated that TASK channels in cholinergic neurons are molecular substrates for select actions of inhaled anesthetics PMID: 20519544
  25. Activation and inhibition of protein kinase G respectively upregulates and downregulates recombinant TASK1 channels heterologously expressed in PKG-loaded human embryonic kidney cells. PMID: 20410120
  26. Although significantly reducing its pH sensitivity, mutation of H98 in TASK-1 did not abolish pH sensitivity. H98 is not only residue or domain involved in pH sensing of TASK-1. PMID: 12634929
  27. activation of protein kinase c epsilon is both necessary and sufficient to regulate murine TASK-1 potassium channel current in a heterologous expression system and to induce repolarization abnormalities in isolated myocytes PMID: 15184378
  28. Expression of TASK-1 in mouse is restricted to the developing conduction system PMID: 16145663
  29. TASK-1 channels contribute to the properties of potassium leak conductance in adult cerebellar granule neurons PMID: 16339039
  30. TASK-like conductances are more prevalent in inhibitory interneurons than previously supposed. PMID: 16837582
  31. Residues in the outer pore mouth contribute to selectivity in TASK-1. Mutations resulting in loss of selectivity were associated with slowing of the response of channels to depolarisation. PMID: 17541788
  32. Striking changes in adrenocortical architecture in task1-knockout mice are the first demonstration of the causative role of a potassium channel in development/differentiation. PMID: 18034154
  33. A strict requirement is ruled out for TASK channels or raphe neurons in central respiratory chemosensation. PMID: 18094244
  34. studies establish an animal model of nontumorigenic primary hyperaldosteronism and identify TASK channels as a possible therapeutic target for primary hyperaldosteronism PMID: 18250325
  35. TASK-1 channels play a key role in the control of ventilation by peripheral chemoreceptors. PMID: 18753386
  36. data provide evidence for an important role of functional TASK channels in limiting tissue damage during cerebral ischemia PMID: 18930826
  37. In the isolated, perfused, and ventilated mouse lung model, anandamide and ET-1 have an additive effect on TASK-1 inhibition and resultant vasoconstriction. PMID: 19188660
  38. Our results support a novel role for TASK genes in enhancing neuronal excitability and promoting high-frequency firing, but suggest that TASK1/3 subunits are not essential for orexin cell responses to glucose and pH. PMID: 19508695

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
Two pore domain potassium channel (TC 1.A.1.8) family
Tissue Specificity
Very strong expression in heart, also detected in kidney, brain, skin, testis, lung, skeletal muscle, small intestine and stomach. Not detected in liver, thymus or spleen.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1