Recombinant Mouse Potassium channel subfamily K member 3(Kcnk3)

Code CSB-CF012071MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O35111
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MKRQNVRTLALIVCTFTYLLVGAAVFDALESEPEMIERQRLELRQLELRARYNLSEGGYE ELERVVLRLKPHKAGVQWRFAGSFYFAITVITTIGYGHAAPSTDGGKVFCMFYALLGIPL TLVMFQSLGERINTFVRYLLHRAKRGLGMRHAEVSMANMVLIGFVSCISTLCIGAAAFSY YERWTFFQAYYYCFITLTTIGFGDYVALQKDQALQTQPQYVAFSFVYILTGLTVIGAFLN LVVLRFMTMNAEDEKRDAEHRALLTHNGQAVGLGGLSCLSGSLGDGVRPRDPVTCAAAAG GVGVGVGGSGFRNVYAEVLHFQSMCSCLWYKSREKLQYSIPMIIPRDLSTSDTCVEHSHS SPGGGGRYSDTPSHPCLCSGTQRSAISSVSTGLHSLAAFRGLMKRRSSV
Source in vitro E.coli expression system
Gene Names Kcnk3
Protein Names Recommended name: Potassium channel subfamily K member 3 Alternative name(s): Acid-sensitive potassium channel protein TASK-1 Cardiac two pore background K(+) channel TWIK-related acid-sensitive K(+) channel 1 Two pore potassium channe
Expression Region 1-409
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function pH-dependent, voltage-insensitive, background potassium channel protein. Rectification direction results from potassium ion concentration on either side of the membrane. Acts as an outward rectifier when external potassium concentration is low. When external potassium concentration is high, current is inward.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Two pore domain potassium channel (TC 1.A.1.8) family
Tissue Specificity Very strong expression in heart, also detected in kidney, brain, skin, testis, lung, skeletal muscle, small intestine and stomach. Not detected in liver, thymus or spleen.
Database Links

KEGG: mmu:16527

STRING: 10090.ENSMUSP00000098987

UniGene: Mm.439936

Related Products

Kcnk3 Antibodies

Kcnk3 Antibodies for Mus musculus (Mouse)

Kcnk3 Proteins

Kcnk3 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.