Recombinant Mouse Probable G-protein coupled receptor 156(Gpr156)

Code CSB-CF761328MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6PCP7
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MEPEINCSEFCDSFPGQELDRRPLHDLCKTTITESQHSSTAASPLSPALLGIMWTFLSCG LLLVLFFLAFTIRCRKNRIVKMSSPNLNVVTLLGSCLTYISAYLFGIQDALEGSSVEALI QTRLSLLCIGTSLVFGPILGKSWRLYKVFTQRVPDKRVIIKDLQLLGLVAALVVADVILL VTWVLTDPIQCLQMLGVSMKVTGRDVSCSLTNTHFCASRYSDVWIALVLGCKGLLLLYGA YLAGLTNHVSSPPVNQSLTIMVGVNLLLLTAGLLFVVTRYLHSWPNLVFGLTSGGIFVCT TTVNCCVFIPQLKQWKAFEGENQTMRHMAKYFSTPSKSFHSQFDEDPSCHLRDEKSCMER LLTEKNAVIESLQEQVSNAKEKLVKLMSAECTYDSPEWAVPDAASARGLALPGPSECPAV SENESGAAARDSLHVPAACQHVQGPGASRRDTSPSPAQQDNMPLKQYCDHLDTGCNQKPK AEQSEGPERGDQEPMAPSQRLMADGVACEPHKPRQSPEGLPKKLPGVSSVVREKLQEVLQ ELDLGSEAPLSPLPCPQQLWKSTTSRSPQKLSPSKLGFSPYVVRRRRAAQRARSHIPGSV GLNVGHQANSTVSSSQSGLIVQNRDSPRLDHHNARSKVPRSSSVKPSPLSEPRRKQGTLE GSKQCETEPQEAGGACNVAFPCQSSASVQAQSPAAPCLPSSPALPRQRQPRPRLSPGCPS LSSGCYNLDSESSSSDEFFCRCHRPYCEICFQSSLDSNDSDTSDSDLEQASGLASWEKLW ARSKPVVNFKDDLKPTLV
Source in vitro E.coli expression system
Gene Names Gpr156
Protein Names Recommended name: Probable G-protein coupled receptor 156 Alternative name(s): GABAB-related G-protein coupled receptor
Expression Region 1-798
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Orphan receptor.
Subcellular Location Cell membrane, Multi-pass membrane protein, Cell junction, synapse, postsynaptic cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 3 family, GABA-B receptor subfamily
Database Links

KEGG: mmu:239845

STRING: 10090.ENSMUSP00000055958

UniGene: Mm.228018

Related Products

Gpr156 Proteins

Gpr156 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.