Recombinant Mouse Probable G-protein coupled receptor 19(Gpr19)

Code CSB-CF736804MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q61121
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MVFAHRMDNDQPPVVTATLLVPLQNSSCAEAAEALLPHGLMGLHEEHSWMSNRTELQYEL NPGEVATASIFFGALWLFSIFGNSLVCLVIHRSRRTQSTTNYFVVSMACADLLISVASTP FVVLQFTTGRWTLGSAMCKVVRYFQYLTPGVQIYVLLSICIDRFYTIVYPLSFKVSREKA KKMIAASWILDAAFVTPVFFFYGSNWDSHCNYFLPPSWEGTAYTVIHFLVGFVIPSILII LFYQKVIKYIWRIGTDGRTLRRTMNIVPRTKVKTVKMFLLLNLVFLFSWLPFHVAQLWHP HEQDYKKSSLVFTAVTWVSFSSSASKPTLYSIYNANFRRGMKETFCMSSMKCYRSNAYTI TTSSRMAKRNYVGISEIPPVSRTITKDSIYDSFDREAREKKLAWPINSNPPNTFV
Source in vitro E.coli expression system
Gene Names Gpr19
Protein Names Recommended name: Probable G-protein coupled receptor 19
Expression Region 1-415
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Orphan receptor.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

KEGG: mmu:14760

STRING: 10090.ENSMUSP00000047630

UniGene: Mm.4787

Related Products

Gpr19 Proteins

Gpr19 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.