Recombinant Mouse Probable G-protein coupled receptor 88(Gpr88)

Code CSB-CF887640MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9EPB7
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MTNSSSTSTSTTTGGSLLLLCEEEESWAGRRIPVSLLYSGLAIGGTLANGMVIYLVSSFR KLQTTSNAFIVNGCAADLSVCALWMPQEAVLGLLPSGSAEPPGDWDGGGGSYRLLRGGLL GLGLTVSLLSHCLVALNRYLLITRAPATYQVLYQRRHTVGMLALSWALALGLVLLLPPWA PKPGAEPPQVHYPALLAAGALLAQTALLLHCYLGIVRRVRVSVKRVSVLNFHLLHQLPGC AAAAAAFPAAPHAPGPGGAAHPAQPQPLPAALQPRRAQRRLSGLSVLLLCCVFLLATQPL VWVSLASGFSLPVPWGVQAASWLLCCALSALNPLLYTWRNEEFRRSVRSVLPGVGDAAAA AAAATAVPAMSQAQLGTRAAGQHW
Source in vitro E.coli expression system
Gene Names Gpr88
Protein Names Recommended name: Probable G-protein coupled receptor 88 Alternative name(s): Striatum-specific G-protein coupled receptor
Expression Region 1-384
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Probable G-protein coupled receptor implicated in a large repertoire of behavioral responses that engage motor activities, spatial learning, and emotional processing. May play a role in the regulation of cognitive and motor function.
Subcellular Location Cell membrane, Multi-pass membrane protein, Cytoplasm, Nucleus
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Expressed predominantly in the striatum.
Database Links

KEGG: mmu:64378

STRING: 10090.ENSMUSP00000087959

UniGene: Mm.40025

Related Products

Gpr88 Proteins

Gpr88 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.