Recombinant Mouse Prolactin-releasing peptide receptor(Prlhr)

Code CSB-CF761515MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6VMN6
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MTSLSTETTGDPDLSSGLLPASSTPANQSAEASEGNLSATVPRAAAVTPFQSLQLVHQLK GLIVMLYSIVVVVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMCAACVPLTLAY AFEPRGWVFGGGLCHLVFFLQPVTVYVSVFTLTTIALDRYVVLVHPLRRRISLRLSAYAV LGIWALSAVLALPAAVHTYHVELKPHDVSLCEEFWGSQERQRQIYAWGLLLGTYLLPLLA ILLSYVRVSVKLRNRVVPGSVTQSQADWDRARRRRTFCLLVVVVVVFAVCWLPLHIFNLL RDLDPRAIDPYAFGLVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKMLLSWPRKIVPH GQNMTVSVVI
Source in vitro E.coli expression system
Gene Names Prlhr
Protein Names Recommended name: Prolactin-releasing peptide receptor Short name= PrRP receptor Short name= PrRPR Alternative name(s): G-protein coupled receptor 10
Expression Region 1-370
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for prolactin-releasing peptide (PrRP). Implicated in lactation, regulation of food intake and pain-signal processing.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

KEGG: mmu:226278

STRING: 10090.ENSMUSP00000063114

UniGene: Mm.377241

Related Products

Prlhr Proteins

Prlhr Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.