Recombinant Mouse Prostaglandin E synthase (Ptges)-VLPs

Code CSB-MP018976MO
MSDS
Size
Order now
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Ptges
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Ptges; Pges; Prostaglandin E synthase; mPGES-1; Glutathione peroxidase PTGES; Glutathione transferase PTGES; Microsomal prostaglandin E synthase 1
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
1-153aa
Target Protein Sequence
MPSPGLVMESGQVLPAFLLCSTLLVIKMYAVAVITGQMRLRKKAFANPEDALKRGGLQYYRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPLIAWIHFLVVLTGRVVHTVAYLGKLNPRLRSGAYVLAQFSCFSMALQILWEVAHHL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
If you have specified tag type, please tell us and we will check if it’s possible to develop.
Form
Lyophilized powder
Note: We will default ship it in lyophilized form with normal bule ice packs. However, if you request to ship in liquid form, it needs to be shipped with dry ice, please communicate with us in advance and extra fees for dry ice and dry ice box will be charged.
Buffer
Lyophilized from PBS, 6% Trehalose, pH 7.4
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Terminal enzyme of the cyclooxygenase (COX)-2-mediated prostaglandin E2 (PGE2) biosynthetic pathway. Catalyzes the glutathione-dependent oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2) in response to inflammatory stimuli. Plays a key role in inflammation response, fever and pain. Catalyzes also the oxidoreduction of endocannabinoids into prostaglandin glycerol esters and PGG2 into 15-hydroperoxy-PGE2. In addition, displays low glutathione transferase and glutathione-dependent peroxidase activities, toward 1-chloro-2,4-dinitrobenzene and 5-hydroperoxyicosatetraenoic acid (5-HPETE), respectively.
Gene References into Functions
  1. We conclude that mPGES1 is necessary in vivo to mount optimal Treg and Th17 responses during an Ag-driven primary immune response. PMID: 29237778
  2. mPGES-1 stimulates an intercellular interaction between CD4+ T cells by upregulating the autocrine function of IL-1beta inexperimental autoimmune encephalomyelitis. PMID: 29257087
  3. Microsomal prostaglandin E synthase-1 gene deletion impairs neuro-immune circuitry of the cholinergic anti-inflammatory pathway in endotoxaemic mouse spleen PMID: 29470537
  4. COX-1 and mPGES-1 are co-localized in placental syncytiotrophoblasts-level II, facing fetal-placental circulation PMID: 28487024
  5. COX-2/mPGES-1/PGE2 cascade activation mediates uric acid-induced glomerular mesangial cell proliferation. PMID: 28052039
  6. that mPGES-1 exerts a potentially protective effect against renal fibrosis and inflammation induced by unilateral ureteral obstruction in mice PMID: 27784694
  7. In line with the acetyltransferase activity of p300, H3K27 acetylation was reduced after HDACi and resulted in the formation of heterochromatin in the PTGES1 gene. In conclusion, HDAC activity maintains PTGES1 expression by recruiting p300 to its gene PMID: 27913583
  8. The findings suggest that COX-2/mPGES-1/PGE2 axis could be activated by albumin in the proximal tubular cells via a NLRP3 inflammasome-mediated mechanism and could thus contribute to proteinuria-related renal tubular cell injury. PMID: 28628921
  9. mPGES-1 overexpression prevents Fas-induced hepatocyte apoptosis and liver injury through activation of Akt . PMID: 27102561
  10. The expression of Lcn2 and mPGES-1 is strongly stimulated by lipopolysaccharide (LPS), indicating that Lcn2 mediates LPS-induced inflammation. These findings shed light on the role of Lcn2 during decidualization. PMID: 27416888
  11. The results show that mPges-1 may be a direct downstream target gene of the P4 receptor. PMID: 27174800
  12. mPges-1 depletion modestly increased thrombogenesis in LDL-receptor knockout mice. This response was markedly further augmented by coincident deletion of the I prostanoid receptor. PMID: 27440004
  13. Data (including data from studies in knockout mice) suggest interactions of cholinergic/prostaglandin systems participate in neuroimmunomodulation; microsomal Ptges-1 is part of cholinergic anti-inflammatory response in chronic inflammatory diseases. PMID: 26001880
  14. Prostacyclin synthase and prostaglandin E synthase-1 cooperatively exacerbate inflammatory reactions but have opposing effects on carcinogenesis. PMID: 26611322
  15. Gas6, through upregulation of Ptges/PGE2, contributes to cancer-induced venous thrombosis. PMID: 26585956
  16. Vascular mPGES-1 plays a protective role in blood vessels and attenuates rupture of cerebral aneurysms. PMID: 26134597
  17. Suggest pivotal role of COX-2-mPGES-1-PGE2 axis in vascular calcification. Inhibition of COX-2 or mPGES-1 may increase the risk of calcification and subsequent adverse cardiovascular events during chronic renal failure. PMID: 26543101
  18. The present results suggest that mPGES-1 plays a significant role in lymphangiogenesis during inflammation, and represents a novel target for controlling IL. PMID: 26459051
  19. data suggests that an as yet unidentified prostaglanind E synthase but not mPGES-1 may couple with COX-2 to mediate increased renal PGE2 sythsesis in DN. PMID: 24984018
  20. This study shown that mPGES-1 is expressed in the mouse brain, both in vascular endothelial cells, in several other cellular of capillary associated pericytes, astrocytes, and cells in circumventricular organs, choroid plexus, and leptomeninges. PMID: 24668417
  21. mPGES-1 deficiency exacerbates bleomycin-induced pulmonary fibrosis. PMID: 24756129
  22. mPGES-1 appears to be critical for tumor metastasis in prostate cancers PMID: 24291175
  23. Melatonin modulates microsomal PGE synthase 1 and NF-E2-related factor-2-regulated antioxidant enzyme expression in LPS-induced murine peritoneal macrophages. PMID: 24116971
  24. Genetic deletion of mPGES-1 affects eicosanoid profiles in LPS-induced mouse peritoneal macrophages. PMID: 23916744
  25. genetic ablation improves survival against lethal influenza A infection PMID: 24726877
  26. mPGES-1 contributes to mammary tumor growth PMID: 23624019
  27. In contrast to exaggeration of the response to vascular injury, deletion of mPGES-1 in vascular smooth muscle sells, endothelial cells, or both had no detectable phenotypic impact on atherogenesis. PMID: 24753592
  28. mPGES-1 and its product PGE2 are important negative regulators of neutrophil-mediated arthritis inflammation. PMID: 24055573
  29. PGE2 is a key regulator of white-to-brown adipogenesis; there may be coordinate regulation of adipogenesis between PPARgamma and mPGES-1 PMID: 23943621
  30. results suggest that central PGE(2) derived from non-neuronal mPGES-1 aggravates the disruption of the vessel structure, leading to the spread of inflammation and local demyelination in the spinal cord, which corresponds to the symptoms of EAE PMID: 23266396
  31. Activation of mPGES-1 is involved in the rapid and vital response to severe hypoxia as well as inflammation. PMID: 22926547
  32. Deletion of mPGES-1 in the vasculature and myeloid cells differentially modulates the response to vascular injury, implicating macrophage mPGES-1 as a cardiovascular drug target. PMID: 23204105
  33. results indicate that PGE(2) was synthesized by PTGES1 in adipocytes and synergistically suppressed the early phase of adipogenesis of 3T3-L1 cells in cooperation with PGF(2alpha) through receptor-mediated activation of PTGS2 expression PMID: 22970288
  34. These results suggest that mPGES-1-derived PGE(2) contributes to dehydration natriuresis likely via NO/cGMP. PMID: 23171554
  35. PGE2 produced by microsomal PGES-1 regulates the onset of wakefulness and the maintenance of circadian rhythm. PMID: 21784115
  36. Cyclooxygenase-2, not microsomal prostaglandin E synthase-1, is the mechanism for interleukin-1beta-induced prostaglandin E2 production and inhibition of insulin secretion in pancreatic islets PMID: 22822059
  37. These results indicated that mPGES-1 is induced during Abeta-mediated neuronal cell death and is involved in Abeta-induced neurotoxicity associated with Alzheimer's disease pathology. PMID: 22766501
  38. a tight cooperation between the EGF/EGFR and mPGES-1 leads to a significant tumorigenic gain in epithelial cells. PMID: 22081067
  39. mPGES-1 upregulation upon lactational TCDD exposure is a causal factor for TCDD-induced hydronephrosis in mouse neonates. PMID: 22430074
  40. It was shown that microsomal prostaglandin E synthase 1 is involved in multiple steps of early to late stages of carcinogenesis, likely by altering the balance of pro- and antitumorigenic lipid mediators and thereby several signaling pathways. PMID: 21986945
  41. Lack of mPGES-1 in bone marrow-derived leukocytes negatively regulates COX-1 expression, PGE2 biosynthesis, and inflammation in myocrdial infarct and leads to impaired left ventricle function, adverse LV remodeling, and decreased survival. PMID: 22589381
  42. imidazoquinolines represent a novel structural class of microsomal prostaglandin E synthase-1 inhibitors PMID: 22137787
  43. The results suggest that mPGES-1 in motor neurons may play a role in the pathogenesis of ALS; mPGES-1 may work sequentially in motor neurons and activated microglia to produce ALS symptoms in G93A mice PMID: 22302024
  44. The results suggested that mPGES-1-derived PGE2 reduces urine concentrating ability through suppression of renal medullary expression of V2 receptors and aquaporin 2 but may enhance it by mediating the central arginine vasopressin response. PMID: 22237797
  45. study demonstrate that activation of PKA/CREB signalling through the EP2 receptor by PGE2 plays a key role in the expression of COX-2 and mPGES-1 in activated macrophages PMID: 22268508
  46. We conclude that mPGES-1 deletion ameliorates chronic renal failure in the mouse model of renal mass reduction, and mPGES-1 deletion paradoxically exacerbates anemia in this model likely via suppression of erythropoietin synthesis. PMID: 22106404
  47. Cigarette smoke in association with cytokines alters the balance between prostacyclin and prostagland E2, reducing prostacyclin production and increasing synthesis and activity of mPGES-1 via NADPH-oxidase activation. PMID: 21737615
  48. mPGES-1 expression is required for bleomycin-induced skin fibrogenesis. PMID: 21266028
  49. mPGES-1 knockout mice were used to evaluate the immunoregulatory effects associated with the genetic deletion of mPGES-1 in dendritic cells were evaluated. PMID: 21190819
  50. found that endothelial mPGES-1 produced PGE(2) that enhanced astrocytic Ca(2+) levels via EP3 receptors and increased Ca(2+)-dependent glutamate release, aggravating neuronal injury PMID: 21219953

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein. Cytoplasm, perinuclear region.
Protein Families
MAPEG family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*